LXL04_005107 | RubberDandelionOmics

Gene overview

LXL04_005107

Reference: OH-1004 Chr: Chr01 Coordinates: 155000791-155001186 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

396 bp · LXL04_005107|LXL04_005107|OH1004|cDNA

ATGGCTTCAAAGGCATTGGCAACCACTGCTTTCCTCCTCGCTCTCAACCTTGTCTTCTTCACTCTTGTGAGTTCAACCTCTTGCCCACCACCAGCAACGCCAGTGACCCCTAAGCCACCAAAGCATCACCACAAAGCTACCTGCCCAAAAGACACCCTGAAGCTTGGTGTGTGCACAAATGTGCTCAATGACCTGGTTCACCTAGTCGTGGGTACACCAGCAAAGACACCTTGCTGCAGCCTCATCGGGAACCTTGTGGA...

CDS

Download CDS FASTA

396 bp · LXL04_005107|LXL04_005107|OH1004|CDS

ATGGCTTCAAAGGCATTGGCAACCACTGCTTTCCTCCTCGCTCTCAACCTTGTCTTCTTCACTCTTGTGAGTTCAACCTCTTGCCCACCACCAGCAACGCCAGTGACCCCTAAGCCACCAAAGCATCACCACAAAGCTACCTGCCCAAAAGACACCCTGAAGCTTGGTGTGTGCACAAATGTGCTCAATGACCTGGTTCACCTAGTCGTGGGTACACCAGCAAAGACACCTTGCTGCAGCCTCATCGGGAACCTTGTGGA...

Protein

Download Protein FASTA

131 aa · LXL04_005107|LXL04_005107|OH1004|PROTEIN

MASKALATTAFLLALNLVFFTLVSSTSCPPPATPVTPKPPKHHHKATCPKDTLKLGVCTNVLNDLVHLVVGTPAKTPCCSLIGNLVDLEAAVCLCTALKANVLGINLNVPVSLSLLLNVCGKKVPKGFQCA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005107`
TK1151 ID	TkA01G080990
OH-1004 ID	LXL04_005107
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	92.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005107

Location Chr01:155000791-155001186 (-)

Description Similar to EARLI1: Lipid transfer protein EARLI 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12480`	Probable lipid transfer protein (LTP).	Cold responsive EARLI1 type HyPRPs improve freezing survival of yeast cells and form higher order complexes in plants.2007 · DOI: 10.1007/s00425-007-0611-2 The HyPRP gene EARLI1 has an auxiliary role for germinability and early seedling development under low temperature and salt stress conditions in Arabidopsis thaliana.2011 · DOI: 10.1007/s00425-011-1425-9 Influence of EARLI1-like genes on flowering time and lignin synthesis of Arabidopsis thaliana.2011 · DOI: 10.1111/j.1438-8677.2010.00428.x Expression of recombinant EARLI1, a hybrid proline-rich protein of Arabidopsis, in Escherichia coli and its inhibition effect to the growth of fungal pathogens and Saccharomyces cerevisiae.2012 · DOI: 10.1016/j.gene.2012.06.070
`At4g12470`	Probable lipid transfer protein (LTP).	Priming in systemic plant immunity.2009 · DOI: 10.1126/science.1170025 Cold-inducible expression of AZI1 and its function in improvement of freezing tolerance of Arabidopsis thaliana and Saccharomyces cerevisiae.2011 · DOI: 10.1016/j.jplph.2011.01.023 Influence of EARLI1-like genes on flowering time and lignin synthesis of Arabidopsis thaliana.2011 · DOI: 10.1111/j.1438-8677.2010.00428.x Metabolomic analysis reveals the relationship between AZI1 and sugar signaling in systemic acquired resistance of Arabidopsis.2016 · DOI: 10.1016/j.plaphy.2016.06.016
`At4g12500`	Probable lipid transfer protein (LTP).	No verified direct reference in this release
`At4g12490`	Probable lipid transfer protein (LTP).	Influence of EARLI1-like genes on flowering time and lignin synthesis of Arabidopsis thaliana.2011 · DOI: 10.1111/j.1438-8677.2010.00428.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005107 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009682 induced systemic resistance Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT4G12470

ath:AT4G12480

ath:AT4G12490

ath:AT4G12500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.541

Rank 1 · LXL04_005107 · OH-1004

Cytoplasm0.159

Rank 2 · LXL04_005107 · OH-1004

Lysosome / Vacuole0.158

Rank 3 · LXL04_005107 · OH-1004

Endoplasmic reticulum0.151

Rank 4 · LXL04_005107 · OH-1004

Cell membrane0.102

Rank 5 · LXL04_005107 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14368.12LTP_238-130 aa

PF14547.12Hydrophob_seed47-131 aa

PF00234.28Tryp_alpha_amyl48-130 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005107	`PF14368.12`	LTP_2	38	130	7e-06	26.8
LXL04_005107	`PF14547.12`	Hydrophob_seed	47	131	8.3e-27	94.1
LXL04_005107	`PF00234.28`	Tryp_alpha_amyl	48	130	9.4e-16	58.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39176`	Arabidopsis thaliana	Lipid transfer protein EARLI 1	45.238%	Swiss-Prot	moderate database homology
`Q9SU35`	Arabidopsis thaliana	pEARLI1-like lipid transfer protein 1	47.826%	Swiss-Prot	moderate database homology
`Q9SU33`	Arabidopsis thaliana	pEARLI1-like lipid transfer protein 3	42.938%	Swiss-Prot	moderate database homology
`Q9SU34`	Arabidopsis thaliana	pEARLI1-like lipid transfer protein 2	42.623%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card