Gene Card
Gene overview
cDNA / CDS / Protein Sequences
540 bp · LXL04_004546|LXL04_004546|OH1004|cDNA
ATGAGGAAACAGGTCCAAAAACCTGAAACAATTCATACTATTTTTACCATGAATTTGATTATTATGGTTTTGTGTATTTCAGCTCTCAATCCTGATAAATGGTTAGTGTTTAAGCAGCAAGAGAAGGCTAAAGTCAATTTTCTTTTGATCCAAATCTTGAATTGGGACTCGGTGTTGCATCATGCCTCATCACCAGGCAAGTTTCTGAACACATTTATGAAATATCGCTTGCCACGGCTCCATTGGAAGAAGATGCTGAA...
540 bp · LXL04_004546|LXL04_004546|OH1004|CDS
ATGAGGAAACAGGTCCAAAAACCTGAAACAATTCATACTATTTTTACCATGAATTTGATTATTATGGTTTTGTGTATTTCAGCTCTCAATCCTGATAAATGGTTAGTGTTTAAGCAGCAAGAGAAGGCTAAAGTCAATTTTCTTTTGATCCAAATCTTGAATTGGGACTCGGTGTTGCATCATGCCTCATCACCAGGCAAGTTTCTGAACACATTTATGAAATATCGCTTGCCACGGCTCCATTGGAAGAAGATGCTGAA...
Protein
Download Protein FASTA179 aa · LXL04_004546|LXL04_004546|OH1004|PROTEIN
MRKQVQKPETIHTIFTMNLIIMVLCISALNPDKWLVFKQQEKAKVNFLLIQILNWDSVLHHASSPGKFLNTFMKYRLPRLHWKKMLKEKQNMLFALFFKTKAGGCCGSKRENHLVKLLITLIPSVNSNAGGSGITPRLQVIEAIVKNPDDTTKVRVSLIYANVSPDDILLKKETRHACC
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_004546 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_004546 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:139807081-139808251 (+) | |||||||||
| Description | Similar to CBR2: NADH-cytochrome b5 reductase-like protein | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0002926 tRNA wobble base 5-methoxycarbonylmethyl-2-thiouridinylation Biological Process GO:0006696 ergosterol biosynthetic process Biological Process GO:0017183 protein histidyl modification to diphthamide Biological Process GO:0022900 electron transport chain Biological Process GO:0005739 mitochondrion Cellular Component GO:0005741 mitochondrial outer membrane Cellular Component GO:0005758 mitochondrial intermembrane space Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009505 plant-type cell wall Cellular Component | |||||||||
| KEGG gene cross-reference | aor:AO090003000873 ath:AT5G17770 ath:AT5G20080 ddi:DDB_G0285399 dha:DEHA2C07238g These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00175.27NAD_binding_1129-175 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_004546 | PF00175.27 | NAD_binding_1 | 129 | 175 | 6.5e-08 | 33.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.