LXL04_004144 | RubberDandelionOmics

Gene overview

LXL04_004144

Reference: OH-1004 Chr: Chr01 Coordinates: 126374544-126377672 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1443 bp · LXL04_004144|LXL04_004144|OH1004|cDNA

ATGGCTATGGTGACCAGCTTCATCTCGTTACTATTTGTCGTTTTGATCTCTGTTTCCGTGGCTGCAAGTAACGACGGCGATTTCAGCGGTGCTGTTTTCGGTGTGAATTCGAAATTCTCTGGAAAGGAACGGTCGCTTAGTCTTTTCAAAGCTCACGATAGCCTCCGTCACCTTCAGATTCTAGCATCTGGTGTCGACCTACCTCTCGGTGGAACCGGTCGTCCTGATGCCGTCGGGCTTTACTATGCCAAAATTGGAAT...

CDS

Download CDS FASTA

1443 bp · LXL04_004144|LXL04_004144|OH1004|CDS

ATGGCTATGGTGACCAGCTTCATCTCGTTACTATTTGTCGTTTTGATCTCTGTTTCCGTGGCTGCAAGTAACGACGGCGATTTCAGCGGTGCTGTTTTCGGTGTGAATTCGAAATTCTCTGGAAAGGAACGGTCGCTTAGTCTTTTCAAAGCTCACGATAGCCTCCGTCACCTTCAGATTCTAGCATCTGGTGTCGACCTACCTCTCGGTGGAACCGGTCGTCCTGATGCCGTCGGGCTTTACTATGCCAAAATTGGAAT...

Protein

Download Protein FASTA

480 aa · LXL04_004144|LXL04_004144|OH1004|PROTEIN

MAMVTSFISLLFVVLISVSVAASNDGDFSGAVFGVNSKFSGKERSLSLFKAHDSLRHLQILASGVDLPLGGTGRPDAVGLYYAKIGIGTPPKEYYVQVDTGSDIMWINCIQCRECPKRGYHGLELTLYDPEDSFTGKLVTCSQDFCAEINGGAVTGCKANASCLYTETYGDGSYSIGYFVMDVVQYDSVSGDLETKLANGSVIFGCGARQSGNLGSSEDALDGILGFGKSNSSIISQLASSGKVKKMFAHCLDGDNGGGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004144`
TK1151 ID	TkA01G197400
OH-1004 ID	LXL04_004144
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004144

Location Chr01:126374544-126377672 (+)

Description Similar to At1g65240: Aspartic proteinase-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g36260`	Displays aspartic proteolytic activity.	No verified direct reference in this release
`At1g65240`	Displays aspartic proteolytic activity.	No verified direct reference in this release
`At1g49050`	Involved in proteolytic processing of BAG6 and plant basal immunity.	Aspartyl Protease-Mediated Cleavage of BAG6 Is Necessary for Autophagy and Fungal Resistance in Plants.2016 · DOI: 10.1105/tpc.15.00626
`At5g10080`	Aspartic proteinase-like protein 1.	No verified direct reference in this release
`At2g17760`	Aspartyl protease.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004144 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009555 pollen development Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G49050

ath:AT1G65240

ath:AT2G17760

ath:AT5G10080

ath:AT5G36260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.425

Rank 1 · LXL04_004144 · OH-1004

Extracellular0.182

Rank 2 · LXL04_004144 · OH-1004

Lysosome / Vacuole0.156

Rank 3 · LXL04_004144 · OH-1004

Cytoplasm0.125

Rank 4 · LXL04_004144 · OH-1004

Endoplasmic reticulum0.124

Rank 5 · LXL04_004144 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14543.12TAXi_N81-264 aa

PF00026.29Asp81-389 aa

PF14541.12TAXi_C282-417 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004144	`PF14543.12`	TAXi_N	81	264	3.1e-40	139.0
LXL04_004144	`PF00026.29`	Asp	81	389	8.6e-17	62.3
LXL04_004144	`PF14541.12`	TAXi_C	282	417	1.6e-12	48.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q4V3D2`	Arabidopsis thaliana	Aspartic proteinase 36	46.916%	Swiss-Prot	moderate database homology
`Q9S9K4`	Arabidopsis thaliana	Aspartic proteinase 39	44.956%	Swiss-Prot	moderate database homology
`Q9M9A8`	Arabidopsis thaliana	Aspartyl protease APCB1	31.054%	Swiss-Prot	moderate database homology
`Q9LX20`	Arabidopsis thaliana	Aspartic proteinase-like protein 1	29.641%	Swiss-Prot	weak database homology
`Q8VYV9`	Arabidopsis thaliana	Aspartyl protease family protein 1	30.189%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card