LXL04_003577 | RubberDandelionOmics

Gene overview

LXL04_003577

Reference: OH-1004 Chr: Chr01 Coordinates: 86543392-86545211 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1761 bp · LXL04_003577|LXL04_003577|OH1004|cDNA

ATGGAAACATTGTCATGCTCCCTAAACTCGCATTTATCATCCCACAAACATACCAAACTCCATTGCCGGACTATAAGCATTAAACCCCAACCTGCAGCTCTCATCGTTTCCATCTTCGGAATTAAACCACTAATTACCCGAAAAAGTTTCAAACACGAAAATCCAACACGTCTTGATTCAAAAAACGGATTGCtcaaaaaaatatttaaaacactCGACGGACTAGTGAAGTTCCTCGATCCTCCACTTCACTTATCAGT...

CDS

Download CDS FASTA

1761 bp · LXL04_003577|LXL04_003577|OH1004|CDS

ATGGAAACATTGTCATGCTCCCTAAACTCGCATTTATCATCCCACAAACATACCAAACTCCATTGCCGGACTATAAGCATTAAACCCCAACCTGCAGCTCTCATCGTTTCCATCTTCGGAATTAAACCACTAATTACCCGAAAAAGTTTCAAACACGAAAATCCAACACGTCTTGATTCAAAAAACGGATTGCTCAAAAAAATATTTAAAACACTCGACGGACTAGTGAAGTTCCTCGATCCTCCACTTCACTTATCAGT...

Protein

Download Protein FASTA

586 aa · LXL04_003577|LXL04_003577|OH1004|PROTEIN

METLSCSLNSHLSSHKHTKLHCRTISIKPQPAALIVSIFGIKPLITRKSFKHENPTRLDSKNGLLKKIFKTLDGLVKFLDPPLHLSVDANHILSDNFAPVGELVPTKCEVIYGSIPRYLDGVYIRNGPNPQFHPNGPYHYFDGDGMVHSIRISKGRATFCSRYVKTNKYLIEQQLGSHVVPNIIGGARGIGPFMVRAIVFFARVFLGLYDISSGIGVANTNLAIFGGRTFALCESDIPYTIKIKNDGDVITSGPHDFDGQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003577`
TK1151 ID	TkA01G007180
OH-1004 ID	LXL04_003577
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	56.900
Protein coverage (%)	TK1151 98.283 / OH-1004 42.321 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003577

Location Chr01:86543392-86545211 (-)

Description Similar to CCD4: Probable carotenoid cleavage dioxygenase 4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g19170`	May be involved in carotenoid cleavage.	No verified direct reference in this release
`At1g30100`	Has a 11,12(11',12') 9-cis epoxycarotenoid cleavage activity.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0704000`	Has a 11,12(11',12') 9-cis epoxycarotenoid cleavage activity.	No verified direct reference in this release
`Os12g0435200`	Has a 11,12(11',12') 9-cis epoxycarotenoid cleavage activity.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003577 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009688 abscisic acid biosynthetic process Biological Process

GO:0010162 seed dormancy process Biological Process

GO:0016121 carotene catabolic process Biological Process

GO:1901811 beta-carotene catabolic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009509 chromoplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0010287 plastoglobule Cellular Component

KEGG gene cross-reference

ath:AT1G30100

ath:AT4G19170

dosa:Os02g0704000

dosa:Os12g0435200

osa:4330451

osa:4352125

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.953

Rank 1 · LXL04_003577 · OH-1004

Mitochondrion0.057

Rank 2 · LXL04_003577 · OH-1004

Cytoplasm0.038

Rank 3 · LXL04_003577 · OH-1004

Peroxisome0.032

Rank 4 · LXL04_003577 · OH-1004

Cell membrane0.023

Rank 5 · LXL04_003577 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03055.22RPE6597-578 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003577	`PF03055.22`	RPE65	97	578	1.3e-115	387.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49675`	Arabidopsis thaliana	Probable carotenoid cleavage dioxygenase 4, chloroplastic	54.478%	Swiss-Prot	strong database homology
`Q9C6Z1`	Arabidopsis thaliana	Probable 9-cis-epoxycarotenoid dioxygenase NCED5, chloroplastic	39.011%	Swiss-Prot	moderate database homology
`Q6YVJ0`	Oryza sativa subsp. japonica	9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic	53.010%	Swiss-Prot	strong database homology
`Q5MBR6`	Oryza sativa subsp. japonica	9-cis-epoxycarotenoid dioxygenase NCED2, chloroplastic	49.621%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card