LXL04_002264 | RubberDandelionOmics

Gene overview

LXL04_002264

Reference: OH-1004 Chr: Chr01 Coordinates: 44857492-44858415 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

558 bp · LXL04_002264|LXL04_002264|OH1004|cDNA

ATGGGACTCCTCAGCATCATTCGGAAGATCAAAcggaaagaaaaagaaatgcgTATTCTTATGGTGGGACTTGACAATTCTGGGAAGACAACAATAGTGTTGAAAATCAATGGTGAAGATACCAGTGTTATCAGCCCTACTCTTGGCTTCAACATCAAAACCATGACCTATGATAAGTATACCCTAAACATATGGGATGTTGGAGGTCAAAAGACTATACGGTCTTACTGGAGAAACTACTTTGAGCAGACTGATGGATT...

CDS

Download CDS FASTA

558 bp · LXL04_002264|LXL04_002264|OH1004|CDS

ATGGGACTCCTCAGCATCATTCGGAAGATCAAACGGAAAGAAAAAGAAATGCGTATTCTTATGGTGGGACTTGACAATTCTGGGAAGACAACAATAGTGTTGAAAATCAATGGTGAAGATACCAGTGTTATCAGCCCTACTCTTGGCTTCAACATCAAAACCATGACCTATGATAAGTATACCCTAAACATATGGGATGTTGGAGGTCAAAAGACTATACGGTCTTACTGGAGAAACTACTTTGAGCAGACTGATGGATT...

Protein

Download Protein FASTA

185 aa · LXL04_002264|LXL04_002264|OH1004|PROTEIN

MGLLSIIRKIKRKEKEMRILMVGLDNSGKTTIVLKINGEDTSVISPTLGFNIKTMTYDKYTLNIWDVGGQKTIRSYWRNYFEQTDGLVWVVDSSDLRRLDDCKYELDNLLKEERLSGASLLVFANKQDIQGALSPNEIAKVLNLDAMDKTRHWRIVGCSAYTGEGLLEGFDWLVQDVASRIYVLD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002264`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002264

Location Chr01:44857492-44858415 (+)

Description Similar to ARL2: ADP-ribosylation factor-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g18390`	Has a role in the cofactor-dependent pathway of microtubule biogenesis.	The TITAN5 gene of Arabidopsis encodes a protein related to the ADP ribosylation factor family of GTP binding proteins.2000 · DOI: 10.1105/tpc.12.8.1379

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002264 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0006110 regulation of glycolytic process Biological Process

GO:0006457 protein folding Biological Process

GO:0007021 tubulin complex assembly Biological Process

GO:0007098 centrosome cycle Biological Process

GO:0009558 embryo sac cellularization Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009960 endosperm development Biological Process

GO:0010811 positive regulation of cell-substrate adhesion Biological Process

GO:0015870 acetylcholine transport Biological Process

GO:0031113 regulation of microtubule polymerization Biological Process

GO:0031116 positive regulation of microtubule polymerization Biological Process

KEGG gene cross-reference

ath:AT2G18390

bta:511349

hsa:402

mmu:56327

rno:65142

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.391

Rank 1 · LXL04_002264 · OH-1004

Golgi apparatus0.341

Rank 2 · LXL04_002264 · OH-1004

Lysosome / Vacuole0.189

Rank 3 · LXL04_002264 · OH-1004

Endoplasmic reticulum0.154

Rank 4 · LXL04_002264 · OH-1004

Cell membrane0.149

Rank 5 · LXL04_002264 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025.28Arf4-176 aa

PF09439.17SRPRB16-143 aa

PF08477.20Roc18-128 aa

PF00071.29Ras18-177 aa

PF04670.19Gtr1_RagA18-129 aa

PF01926.30MMR_HSR118-125 aa

PF00503.27G-alpha45-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002264	`PF00025.28`	Arf	4	176	1e-69	234.2
LXL04_002264	`PF09439.17`	SRPRB	16	143	1.1e-08	35.4
LXL04_002264	`PF08477.20`	Roc	18	128	1.2e-11	45.6
LXL04_002264	`PF00071.29`	Ras	18	177	1e-10	42.2
LXL04_002264	`PF04670.19`	Gtr1_RagA	18	129	2.7e-08	34.2
LXL04_002264	`PF01926.30`	MMR_HSR1	18	125	6.3e-06	27.0
LXL04_002264	`PF00503.27`	G-alpha	45	128	1.1e-11	45.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZPX1`	Arabidopsis thaliana	ADP-ribosylation factor-like protein 2	90.270%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card