LXL04_002190 | RubberDandelionOmics

Gene overview

LXL04_002190

Reference: OH-1004 Chr: Chr01 Coordinates: 43604719-43606359 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1641 bp · LXL04_002190|LXL04_002190|OH1004|cDNA

ATGATCAAGCAAAACTCCATGTTCTTACCTTCTTTCCCCATGAACACAAACCCAGTTTCTGAAACAATGTTGTTTGGAGAACCAGATCCGGATCTCAACTCGGGTCAAATCATGGATTGGCTAGAAGACTCACTACCATACCTTCCATCTCTTTTAGATGATCTCTATGATTCCACTGATATCATCGATGATCCATGGTGGGCACCAGTGGAAGAGCTAGAACATGACATCATCAATGCCGATATTTTTTCTACTTTTGA...

CDS

Download CDS FASTA

1641 bp · LXL04_002190|LXL04_002190|OH1004|CDS

ATGATCAAGCAAAACTCCATGTTCTTACCTTCTTTCCCCATGAACACAAACCCAGTTTCTGAAACAATGTTGTTTGGAGAACCAGATCCGGATCTCAACTCGGGTCAAATCATGGATTGGCTAGAAGACTCACTACCATACCTTCCATCTCTTTTAGATGATCTCTATGATTCCACTGATATCATCGATGATCCATGGTGGGCACCAGTGGAAGAGCTAGAACATGACATCATCAATGCCGATATTTTTTCTACTTTTGA...

Protein

Download Protein FASTA

546 aa · LXL04_002190|LXL04_002190|OH1004|PROTEIN

MIKQNSMFLPSFPMNTNPVSETMLFGEPDPDLNSGQIMDWLEDSLPYLPSLLDDLYDSTDIIDDPWWAPVEELEHDIINADIFSTFESVENLTSTVSSTVTSSAPSPPTELPGVPDQPPQPAFDLSKKRKAPPEEGKRSNGNKKGTGKSTKDSSGNSGNDGRWAEQLLKPCAAAIAAGNATRVQHLLFVLHELASPTGDANYRLASHGLQALLHHLSSSTNTPRKVVTPVTSFTTATPKFFQRSLINFNDINPWFTIPFN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002190`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002190

Location Chr01:43604719-43606359 (-)

Description Similar to NSP1: Protein NODULATION SIGNALING PATHWAY 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13840`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At3g49950`	Probable transcription factor involved in plant development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0408600`	Transcription factor involved in the control of strigolactone biosynthesis in roots through the activation of the beta-carotene isomerase D27, which participates in a pathway leading to biosynthesis of strigolactones.	Strigolactone biosynthesis in Medicago truncatula and rice requires the symbiotic GRAS-type transcription factors NSP1 and NSP2.2011 · DOI: 10.1105/tpc.111.089771

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002190 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009877 nodulation Biological Process

GO:0042446 hormone biosynthetic process Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G13840

ath:AT3G49950

mtr:11434050

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.898

Rank 1 · LXL04_002190 · OH-1004

Cytoplasm0.154

Rank 2 · LXL04_002190 · OH-1004

Cell membrane0.040

Rank 3 · LXL04_002190 · OH-1004

Endoplasmic reticulum0.035

Rank 4 · LXL04_002190 · OH-1004

Plastid0.024

Rank 5 · LXL04_002190 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03514.21GRAS165-538 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002190	`PF03514.21`	GRAS	165	538	2.5e-79	267.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LRW3`	Arabidopsis thaliana	Scarecrow-like protein 29	47.059%	Swiss-Prot	moderate database homology
`Q9SN22`	Arabidopsis thaliana	Scarecrow-like protein 32	31.671%	Swiss-Prot	moderate database homology
`Q84MQ9`	Oryza sativa subsp. japonica	Protein NODULATION SIGNALING PATHWAY 1	42.752%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card