LXL04_002098 | RubberDandelionOmics

Gene overview

LXL04_002098

Reference: OH-1004 Chr: Chr01 Coordinates: 41628498-41629142 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

645 bp · LXL04_002098|LXL04_002098|OH1004|cDNA

ATGGCGACTCTTGATTCGGCGCTTGACTTCATCAGAAACCATCTTCTCCATGAATATGAAACCCCTAATTGCTCCCCCGAGCCATCGATTTCCGGATCTGATCTATCAGTTTCTGATTATCTAGACTTTCAGGAAGAAACCACGTCTCAGTTCACGGTACCTGATTCGATTGATAATATATCTGTACCATCATATTTGAAAGAAAGAGAGTGCGTTGAGGAGACTCAGGCAAGGGTACACTACAGAGGAGTACGGCAGAG...

CDS

Download CDS FASTA

645 bp · LXL04_002098|LXL04_002098|OH1004|CDS

ATGGCGACTCTTGATTCGGCGCTTGACTTCATCAGAAACCATCTTCTCCATGAATATGAAACCCCTAATTGCTCCCCCGAGCCATCGATTTCCGGATCTGATCTATCAGTTTCTGATTATCTAGACTTTCAGGAAGAAACCACGTCTCAGTTCACGGTACCTGATTCGATTGATAATATATCTGTACCATCATATTTGAAAGAAAGAGAGTGCGTTGAGGAGACTCAGGCAAGGGTACACTACAGAGGAGTACGGCAGAG...

Protein

Download Protein FASTA

214 aa · LXL04_002098|LXL04_002098|OH1004|PROTEIN

MATLDSALDFIRNHLLHEYETPNCSPEPSISGSDLSVSDYLDFQEETTSQFTVPDSIDNISVPSYLKERECVEETQARVHYRGVRQRPWGKYAAEIRDPKRSGRRVWLGTFDTSIEAAKAYDRAAFEMRGRKAILNFPLEIGNSQSDTVAIAGGCRKRRRDVEQTVVAVKKERVAETVDVPLTPSSWKVIGDEDWYGLLNGHLSSPISGGLMAI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002098`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002098

Location Chr01:41628498-41629142 (-)

Description Similar to ERF5: Ethylene-responsive transcription factor 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g51190`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g47230`	Acts as a transcriptional activator.	Arabidopsis ethylene-responsive element binding factors act as transcriptional activators or repressors of GCC box-mediated gene expression.2000 · DOI: 10.1105/tpc.12.3.393
`At5g61600`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002098 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009733 response to auxin Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051301 cell division Biological Process

GO:0070482 response to oxygen levels Biological Process

KEGG gene cross-reference

ath:AT5G47230

ath:AT5G51190

ath:AT5G61600

nsy:104249597

nta:107790518

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.957

Rank 1 · LXL04_002098 · OH-1004

Cytoplasm0.118

Rank 2 · LXL04_002098 · OH-1004

Cell membrane0.025

Rank 3 · LXL04_002098 · OH-1004

Endoplasmic reticulum0.019

Rank 4 · LXL04_002098 · OH-1004

Plastid0.019

Rank 5 · LXL04_002098 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847.27AP280-130 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002098	`PF00847.27`	AP2	80	130	2.1e-16	60.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VY90`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF105	42.723%	Swiss-Prot	moderate database homology
`O80341`	Arabidopsis thaliana	Ethylene-responsive transcription factor 5	52.143%	Swiss-Prot	moderate database homology
`Q9FKG1`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF104	42.202%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card