LXL04_002092 | RubberDandelionOmics

Gene overview

LXL04_002092

Reference: OH-1004 Chr: Chr01 Coordinates: 41599326-41602495 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2529 bp · LXL04_002092|LXL04_002092|OH1004|cDNA

CCTCATTTATTCAACAAGTTACTCCACTCAGCAAAGATGAGCGTAGTTGGATTTGATCTTGGGAACGAGAGTTGTGTTGTGGCAGTTGCCAGACAAAGAGGAATTGATGTTGTTCTTAACGATGAGTCAAAACGTGAGACTCCTGCTCTTGTCTGTTTTGGTGATAAACAACGTTTTCTAGGAACAGCTGGTGCTGCTACCAGTATGATGAACCCCAAAAACACAATCTCCCAAATCAAACGGTTAATAGGCCGTCCCTT...

CDS

Download CDS FASTA

2493 bp · LXL04_002092|LXL04_002092|OH1004|CDS

ATGAGCGTAGTTGGATTTGATCTTGGGAACGAGAGTTGTGTTGTGGCAGTTGCCAGACAAAGAGGAATTGATGTTGTTCTTAACGATGAGTCAAAACGTGAGACTCCTGCTCTTGTCTGTTTTGGTGATAAACAACGTTTTCTAGGAACAGCTGGTGCTGCTACCAGTATGATGAACCCCAAAAACACAATCTCCCAAATCAAACGGTTAATAGGCCGTCCCTTCTCTGATCCTGAACTACAACAAGATCTCAAGGCACT...

Protein

Download Protein FASTA

830 aa · LXL04_002092|LXL04_002092|OH1004|PROTEIN

MSVVGFDLGNESCVVAVARQRGIDVVLNDESKRETPALVCFGDKQRFLGTAGAATSMMNPKNTISQIKRLIGRPFSDPELQQDLKALPFSVTEGPDGFPLINARYLGETKTFTPTQLMGMVFSNMKTIAEKNLNAAVVDCCIGIPIYFTDLQRRAVMDAATIAGLHPLRLMHETTATALAYGIYKTDLPENEQLNVAFVDIGHASMQVCIAGLKKGQLKILAHSFDRCLGGRDFDEVLFQHFAEKFKGDYKIDVFQNARA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002092`
TK1151 ID	TkA01G483760
OH-1004 ID	LXL04_002092
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002092

Location Chr01:41599326-41602495 (-)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79920`	In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions.	No verified direct reference in this release
`At1g79930`	In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions.	No verified direct reference in this release
`At1g11660`	Heat shock 70 kDa protein 16.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002092 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0006986 response to unfolded protein Biological Process

GO:0009408 response to heat Biological Process

GO:1904276 regulation of wax biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0000774 adenyl-nucleotide exchange factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G11660

ath:AT1G79920

ath:AT1G79930

hsa:22824

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.615

Rank 1 · LXL04_002092 · OH-1004

Nucleus0.476

Rank 2 · LXL04_002092 · OH-1004

Cell membrane0.096

Rank 3 · LXL04_002092 · OH-1004

Mitochondrion0.073

Rank 4 · LXL04_002092 · OH-1004

Endoplasmic reticulum0.070

Rank 5 · LXL04_002092 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00012.27HSP703-679 aa

PF06723.20MreB_Mbl133-374 aa

PF27508.1HYOU1_C709-772 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002092	`PF00012.27`	HSP70	3	679	2.8e-155	518.6
LXL04_002092	`PF06723.20`	MreB_Mbl	133	374	9.5e-06	25.4
LXL04_002092	`PF27508.1`	HYOU1_C	709	772	2e-13	51.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HQD4`	Arabidopsis thaliana	Heat shock 70 kDa protein 15	73.621%	Swiss-Prot	strong database homology
`Q9S7C0`	Arabidopsis thaliana	Heat shock 70 kDa protein 14	72.867%	Swiss-Prot	strong database homology
`Q9SAB1`	Arabidopsis thaliana	Heat shock 70 kDa protein 16	50.064%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card