RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_001355
Reference: OH-1004 Chr: Chr01 Coordinates: 24630912-24634483 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2520 bp · LXL04_001355|LXL04_001355|OH1004|cDNA

ATGGAAACAAAGCAACCAAAGTTCACTACGGTGTACAACACCTTGCATGCCACCGTATCAGACAATCAAAAAATGAAAGATCGATATAAAGATTCAAGgaaagaggaagaagaagaagaagaacaacaTATCAATTTGAGGAGCTTGTCAAAGATTATGATCCCTCCGTTGGGTGCTTCATATATACAAAACCATATTCCCTCAAGATCCACCATCATCATATCACCCATGGACTCCAAATATAGGTATTGGCAGACATT...

CDS

Download CDS FASTA

2520 bp · LXL04_001355|LXL04_001355|OH1004|CDS

ATGGAAACAAAGCAACCAAAGTTCACTACGGTGTACAACACCTTGCATGCCACCGTATCAGACAATCAAAAAATGAAAGATCGATATAAAGATTCAAGGAAAGAGGAAGAAGAAGAAGAAGAACAACATATCAATTTGAGGAGCTTGTCAAAGATTATGATCCCTCCGTTGGGTGCTTCATATATACAAAACCATATTCCCTCAAGATCCACCATCATCATATCACCCATGGACTCCAAATATAGGTATTGGCAGACATT...

Protein

Download Protein FASTA

839 aa · LXL04_001355|LXL04_001355|OH1004|PROTEIN

METKQPKFTTVYNTLHATVSDNQKMKDRYKDSRKEEEEEEEQHINLRSLSKIMIPPLGASYIQNHIPSRSTIIISPMDSKYRYWQTLMVVMVAYSAWTYPFEVAFLKSSAQTHKQLYIADSIVDLFFTADIILTFFVAYVDPITHLLVRDPKSIATRYLSTWFVMDLASTLPFELISYLFTGKHRMGLPYTVLGLLRFWRLRRVKQFFTRIEKDIRFNYFWVRCARLLCVTLFLVHCAGCIYYLLAVLYPHEGRTWIATL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_001355
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_001355
LocationChr01:24630912-24634483 (-)
DescriptionSimilar to AKT2: Potassium channel AKT2/3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g22200 Highly selective and weak inward-rectifying potassium channel.
Loss of the AKT2/3 potassium channel affects sugar loading into the phloem of Arabidopsis.2002 · DOI: 10.1007/s00425-002-0895-1
Regulated expression of Arabidopsis shaker K+ channel genes involved in K+ uptake and distribution in the plant.2003 · DOI: 10.1023/a:1022597102282
At2g26650 May act as a highly selective inward-rectifying potassium channel mediating root potassium uptake under low K⁺ conditions.
Regulated expression of Arabidopsis shaker K+ channel genes involved in K+ uptake and distribution in the plant.2003 · DOI: 10.1023/a:1022597102282
A protein kinase, interacting with two calcineurin B-like proteins, regulates K+ transporter AKT1 in Arabidopsis.2006 · DOI: 10.1016/j.cell.2006.06.011
A Ca(2)+ signaling pathway regulates a K(+) channel for low-K response in Arabidopsis.2006 · DOI: 10.1073/pnas.0605129103
A protein phosphorylation/dephosphorylation network regulates a plant potassium channel.2007 · DOI: 10.1073/pnas.0707912104
High-affinity K(+) transport in Arabidopsis: AtHAK5 and AKT1 are vital for seedling establishment and postgermination growth under low-potassium conditions.2010 · DOI: 10.1104/pp.110.154369
A role for the AKT1 potassium channel in plant nutrition.1998 · DOI: 10.1126/science.280.5365.918
At4g32500 Probable potassium channel. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os05g0428700 Probable inward-rectifying potassium channel. No verified direct reference in this release
Os01g0648000 Highly selective inward-rectifying potassium channel that mediates potassium uptake by plant roots.
Rice K+ uptake channel OsAKT1 is sensitive to salt stress.2005 · DOI: 10.1007/s00425-004-1437-9
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_001355 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006813 potassium ion transport Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0042391 regulation of membrane potential Biological Process
GO:0048767 root hair elongation Biological Process
GO:0090333 regulation of stomatal closure Biological Process
GO:1990573 potassium ion import across plasma membrane Biological Process
GO:0005739 mitochondrion Cellular Component
GO:0005789 endoplasmic reticulum membrane Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
KEGG gene cross-reference
ath:AT2G26650
ath:AT4G22200
ath:AT4G32500
dosa:Os01g0648000
dosa:Os05g0428700
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.731
Rank 1 · LXL04_001355 · OH-1004
Cytoplasm0.160
Rank 2 · LXL04_001355 · OH-1004
Endoplasmic reticulum0.107
Rank 3 · LXL04_001355 · OH-1004
Lysosome / Vacuole0.058
Rank 4 · LXL04_001355 · OH-1004
Golgi apparatus0.056
Rank 5 · LXL04_001355 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00520.38Ion_trans81-332 aa
PF07885.23Ion_trans_2241-326 aa
PF00027.36cNMP_binding424-508 aa
PF12796.14Ank_2558-637 aa
PF13637.13Ank_4566-603 aa
PF13857.13Ank_5569-620 aa
PF00023.37Ank583-613 aa
PF13606.13Ank_3583-610 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_001355PF00520.38Ion_trans813321.9e-45155.7
LXL04_001355PF07885.23Ion_trans_22413267e-1349.0
LXL04_001355PF00027.36cNMP_binding4245084e-1659.4
LXL04_001355PF12796.14Ank_25586371.6e-2590.2
LXL04_001355PF13637.13Ank_45666034.7e-1556.0
LXL04_001355PF13857.13Ank_55696201.1e-1764.7
LXL04_001355PF00023.37Ank5836132.5e-2072.1
LXL04_001355PF13606.13Ank_35836107.3e-1348.0
LXL04_001355PF12796.14Ank_26507081.6e-2590.2
LXL04_001355PF13637.13Ank_46557004.7e-1556.0
LXL04_001355PF13857.13Ank_56667161.1e-1764.7
LXL04_001355PF00023.37Ank6797082.5e-2072.1
LXL04_001355PF11834.14KHA7648359.6e-2071.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q38898Arabidopsis thalianaPotassium channel AKT2/364.976%Swiss-Protstrong database homology
Q38998Arabidopsis thalianaPotassium channel AKT141.637%Swiss-Protmoderate database homology
Q9SCX5Arabidopsis thalianaProbable potassium channel AKT540.625%Swiss-Protmoderate database homology
Q75HP9Oryza sativa subsp. japonicaPotassium channel AKT257.934%Swiss-Protstrong database homology
Q0JKV1Oryza sativa subsp. japonicaPotassium channel AKT144.940%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser