LXL04_001352 | RubberDandelionOmics

Gene overview

LXL04_001352

Reference: OH-1004 Chr: Chr01 Coordinates: 24567038-24572281 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3345 bp · LXL04_001352|LXL04_001352|OH1004|cDNA

ATGAGATTCAGTAGCAGCAGTCATGGTGACTATTCAAGAGGCGTTTACAAGGCAATGAGACATAATTGGTCTCAACATGAGAAATACTTGAGCCATGGTAGAATTTTGAAATCCAACTTCCTGATCTCATTGTCAACAGAAAAACCTTCTGCTGAAGAAGCAAAACCTGCAACTGCAAGATCATTCTCTTGTAAAGATCGAAATGTTACAAACCCACAATGCCCACAAGTCGACAAGGCTTGGCAAGCACTTTCCAACCT...

CDS

Download CDS FASTA

3345 bp · LXL04_001352|LXL04_001352|OH1004|CDS

ATGAGATTCAGTAGCAGCAGTCATGGTGACTATTCAAGAGGCGTTTACAAGGCAATGAGACATAATTGGTCTCAACATGAGAAATACTTGAGCCATGGTAGAATTTTGAAATCCAACTTCCTGATCTCATTGTCAACAGAAAAACCTTCTGCTGAAGAAGCAAAACCTGCAACTGCAAGATCATTCTCTTGTAAAGATCGAAATGTTACAAACCCACAATGCCCACAAGTCGACAAGGCTTGGCAAGCACTTTCCAACCT...

Protein

Download Protein FASTA

1114 aa · LXL04_001352|LXL04_001352|OH1004|PROTEIN

MRFSSSSHGDYSRGVYKAMRHNWSQHEKYLSHGRILKSNFLISLSTEKPSAEEAKPATARSFSCKDRNVTNPQCPQVDKAWQALSNLKLSSRSYLKPGKSRPVTNNGIAASFQQFSSDEINSKPDQTTNPFATFTTSVTEPEKAESIQSGVYESNPKNLSHLHHEINDDDDTFQKSYVNKTLTEQFQSSCTTQLSIIKSPPFTPFASNTIVECDDQSLPPELDVDCGHGFKLGNCPEAATHLQDMKDMLISISNDLIDNA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001352`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001352

Location Chr01:24567038-24572281 (+)

Description Similar to RECQL4A: ATP-dependent DNA helicase Q-like 4A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10930`	DNA helicase involved in DNA repair.	Arabidopsis RecQI4A suppresses homologous recombination and modulates DNA damage responses.2005 · DOI: 10.1111/j.1365-313x.2005.02501.x Two closely related RecQ helicases have antagonistic roles in homologous recombination and DNA repair in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0705998104 Topoisomerase 3alpha and RMI1 suppress somatic crossovers and are essential for resolution of meiotic recombination intermediates in Arabidopsis thaliana.2008 · DOI: 10.1371/journal.pgen.1000285 The RecQ helicase AtRECQ4A is required to remove inter-chromosomal telomeric connections that arise during meiotic recombination in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2010.04438.x
`At1g60930`	3'-5' DNA helicase that may play a role in the repair of DNA (By similarity).	Two closely related RecQ helicases have antagonistic roles in homologous recombination and DNA repair in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0705998104

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001352 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0000706 meiotic DNA double-strand break processing Biological Process

GO:0000722 telomere maintenance via recombination Biological Process

GO:0000723 telomere maintenance Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0000725 recombinational repair Biological Process

GO:0000729 DNA double-strand break processing Biological Process

GO:0000731 DNA synthesis involved in DNA repair Biological Process

GO:0000732 DNA strand displacement Biological Process

GO:0006260 DNA replication Biological Process

GO:0006265 DNA topological change Biological Process

GO:0006281 DNA repair Biological Process

KEGG gene cross-reference

ath:AT1G10930

ath:AT1G60930

dme:Dmel_CG6920

sce:YMR190C

spo:2541620

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.669

Rank 1 · LXL04_001352 · OH-1004

Cytoplasm0.329

Rank 2 · LXL04_001352 · OH-1004

Mitochondrion0.073

Rank 3 · LXL04_001352 · OH-1004

Cell membrane0.031

Rank 4 · LXL04_001352 · OH-1004

Endoplasmic reticulum0.022

Rank 5 · LXL04_001352 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04851.22ResIII402-569 aa

PF00270.36DEAD405-574 aa

PF00271.38Helicase_C611-718 aa

PF16124.11RecQ_Zn_bind729-808 aa

PF09382.18RQC815-929 aa

PF00570.29HRDC974-1042 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001352	`PF04851.22`	ResIII	402	569	1.3e-06	29.2
LXL04_001352	`PF00270.36`	DEAD	405	574	1.3e-25	90.8
LXL04_001352	`PF00271.38`	Helicase_C	611	718	2.5e-22	79.9
LXL04_001352	`PF16124.11`	RecQ_Zn_bind	729	808	2.8e-15	57.5
LXL04_001352	`PF09382.18`	RQC	815	929	5.7e-22	78.4
LXL04_001352	`PF00570.29`	HRDC	974	1042	4.1e-15	56.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L840`	Arabidopsis thaliana	ATP-dependent DNA helicase Q-like 4A	56.201%	Swiss-Prot	strong database homology
`Q9FT70`	Arabidopsis thaliana	ATP-dependent DNA helicase Q-like 4B	53.388%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card