LXL04_001063 | RubberDandelionOmics

Gene overview

LXL04_001063

Reference: OH-1004 Chr: Chr01 Coordinates: 19492127-19499262 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3057 bp · LXL04_001063|LXL04_001063|OH1004|cDNA

ATGGACTCAACAATGTACGGCTCAGCAGTAGGGGCACCAATTCCCGGTCGCCGGAGTACCGTGCGCGTTGTGGTTGTCGGTGATCATGGTTCCGGCAAATCAAGCTTAATCTCGGCAGCTGCCTCCGAGAACTTTCCGGAAAGCGTTTCACCTGTTCTTCCTCCTACTCGTCTTCCTGCGGATTACTATCCAGATGGCGTTCCTGTCACCATCATCGACACCGCCTCTAGTTTGCAAGAGAAAGCGAAGCTAGAGGAAGA...

CDS

Download CDS FASTA

3057 bp · LXL04_001063|LXL04_001063|OH1004|CDS

ATGGACTCAACAATGTACGGCTCAGCAGTAGGGGCACCAATTCCCGGTCGCCGGAGTACCGTGCGCGTTGTGGTTGTCGGTGATCATGGTTCCGGCAAATCAAGCTTAATCTCGGCAGCTGCCTCCGAGAACTTTCCGGAAAGCGTTTCACCTGTTCTTCCTCCTACTCGTCTTCCTGCGGATTACTATCCAGATGGCGTTCCTGTCACCATCATCGACACCGCCTCTAGTTTGCAAGAGAAAGCGAAGCTAGAGGAAGA...

Protein

Download Protein FASTA

1018 aa · LXL04_001063|LXL04_001063|OH1004|PROTEIN

MDSTMYGSAVGAPIPGRRSTVRVVVVGDHGSGKSSLISAAASENFPESVSPVLPPTRLPADYYPDGVPVTIIDTASSLQEKAKLEEELKRADAVVLTYACDKPETLNRLQNFWIPELRRLKVKVPVIVVGCKLDLRDEQYTMSLEQTMAPIIQQFREIETCIECRVFCSQPCAVKKRKEGEENMERKEEKGEGKKIVSEVFYYAQKAVLHPTSPLFDHDSQTLKPRCARALKRIFILCDHDIDGALNDSELTEFQVKCFD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001063`
TK1151 ID	TkA01G564210
OH-1004 ID	LXL04_001063
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.100
Protein coverage (%)	TK1151 99.513 / OH-1004 59.430 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001063

Location Chr01:19492127-19499262 (-)

Description Similar to MIRO2: Mitochondrial Rho GTPase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g63150`	Calcium-binding mitochondrial GTPase involved in calcium signaling during salt stress response.	Arabidopsis thaliana MIRO1 and MIRO2 GTPases are unequally redundant in pollen tube growth and fusion of polar nuclei during female gametogenesis.2011 · DOI: 10.1371/journal.pone.0018530
`At5g27540`	Mitochondrial GTPase required to maintain proper development, morphology and intracellular distribution of mitochondria, which in turn are essential for the progress of embryonic cell division, development of haploid male and female gametes, and pollen tube growth.	EMB2473/MIRO1, an Arabidopsis Miro GTPase, is required for embryogenesis and influences mitochondrial morphology in pollen.2008 · DOI: 10.1105/tpc.107.055756 MIRO1 influences the morphology and intracellular distribution of mitochondria during embryonic cell division in Arabidopsis.2011 · DOI: 10.1007/s00299-010-0926-5 Arabidopsis thaliana MIRO1 and MIRO2 GTPases are unequally redundant in pollen tube growth and fusion of polar nuclei during female gametogenesis.2011 · DOI: 10.1371/journal.pone.0018530
`At3g05310`	Mitochondrial GTPase that may be involved in mitochondrion development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001063 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007005 mitochondrion organization Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0003924 GTPase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

GO:0005525 GTP binding Molecular Function

KEGG gene cross-reference

ath:AT3G05310

ath:AT3G63150

ath:AT5G27540

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.552

Rank 1 · LXL04_001063 · OH-1004

Nucleus0.219

Rank 2 · LXL04_001063 · OH-1004

Cell membrane0.203

Rank 3 · LXL04_001063 · OH-1004

Mitochondrion0.100

Rank 4 · LXL04_001063 · OH-1004

Golgi apparatus0.097

Rank 5 · LXL04_001063 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00071.29Ras22-140 aa

PF01926.30MMR_HSR122-113 aa

PF08477.20Roc22-134 aa

PF08356.19EF_assoc_2262-346 aa

PF08355.18EF_assoc_1386-454 aa

PF00071.29Ras463-622 aa

PF00071.29Ras660-760 aa

PF01926.30MMR_HSR1660-739 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001063	`PF00071.29`	Ras	22	140	1.9e-29	103.1
LXL04_001063	`PF01926.30`	MMR_HSR1	22	113	2.1e-17	64.0
LXL04_001063	`PF08477.20`	Roc	22	134	6.6e-15	56.1
LXL04_001063	`PF08356.19`	EF_assoc_2	262	346	2.6e-56	188.3
LXL04_001063	`PF08355.18`	EF_assoc_1	386	454	2.7e-27	94.9
LXL04_001063	`PF00071.29`	Ras	463	622	1.9e-29	103.1
LXL04_001063	`PF00071.29`	Ras	660	760	1.9e-29	103.1
LXL04_001063	`PF01926.30`	MMR_HSR1	660	739	2.1e-17	64.0
LXL04_001063	`PF08356.19`	EF_assoc_2	864	948	2.6e-56	188.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4J0W4`	Arabidopsis thaliana	Mitochondrial Rho GTPase 2	54.795%	Swiss-Prot	moderate database homology
`Q8RXF8`	Arabidopsis thaliana	Mitochondrial Rho GTPase 1	56.318%	Swiss-Prot	moderate database homology
`Q9MA88`	Arabidopsis thaliana	Mitochondrial Rho GTPase 3	43.478%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card