LXL04_000772 | RubberDandelionOmics

Gene overview

LXL04_000772

Reference: OH-1004 Chr: Chr01 Coordinates: 14112911-14114706 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1338 bp · LXL04_000772|LXL04_000772|OH1004|cDNA

ATGATGAGAACCCTAGCTTCAATGGCATTTTGCAAATCGAAACAGCTGAAGAATCTCATCTTCACCCCATTTCTATATCGCCAATTTCTTCCCAAGCCAAGTAGTTTCTCTGATGTTATATACAAGGTTTTGCATCATGAACCAGCTGTTATATCACATGGAAACCAAAGATATATCCCTAGAGGTATCTTCTGGTATAGTTCGGCTCCTATTGACACAGTCATCAAACCACCAGTGAGCCATGTAACCGACACTGTATC...

CDS

Download CDS FASTA

1338 bp · LXL04_000772|LXL04_000772|OH1004|CDS

ATGATGAGAACCCTAGCTTCAATGGCATTTTGCAAATCGAAACAGCTGAAGAATCTCATCTTCACCCCATTTCTATATCGCCAATTTCTTCCCAAGCCAAGTAGTTTCTCTGATGTTATATACAAGGTTTTGCATCATGAACCAGCTGTTATATCACATGGAAACCAAAGATATATCCCTAGAGGTATCTTCTGGTATAGTTCGGCTCCTATTGACACAGTCATCAAACCACCAGTGAGCCATGTAACCGACACTGTATC...

Protein

Download Protein FASTA

445 aa · LXL04_000772|LXL04_000772|OH1004|PROTEIN

MMRTLASMAFCKSKQLKNLIFTPFLYRQFLPKPSSFSDVIYKVLHHEPAVISHGNQRYIPRGIFWYSSAPIDTVIKPPVSHVTDTVSNGSPEAKPKRKKLKGKRAVIRWLKFFRFKKKKDYERMTAEEKILFKLRKARKKEERLNEALNKIEPKETSETTHDPEILTPEEHFYFLKMGIKSKNYVPVGRRGIYQGVILNMHLHWKKHETLQVIVKTFTPDEVKEMAVELARLSGGIVLDIKDDETIIMYRGKNYSQPPTE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000772`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000772

Location Chr01:14112911-14114706 (-)

Description Similar to At3g25440: Uncharacterized CRM domain-containing protein At3g25440, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25440`	Uncharacterized CRM domain-containing protein At3g25440, chloroplastic.	No verified direct reference in this release
`At3g27550`	Involved in the splicing of group II introns in mitochondria.	CFM9, a Mitochondrial CRM Protein, Is Crucial for Mitochondrial Intron Splicing, Mitochondria Function and Arabidopsis Growth and Stress Responses.2019 · DOI: 10.1093/pcp/pcz147
`At3g23070`	Binds specific group II introns in chloroplasts and facilitates their splicing.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0592400`	Binds specific group II introns in chloroplasts and facilitates their splicing.	Two CRM protein subfamilies cooperate in the splicing of group IIB introns in chloroplasts.2008 · DOI: 10.1261/rna.1223708

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000772 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000373 Group II intron splicing Biological Process

GO:0006397 mRNA processing Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0048316 seed development Biological Process

GO:0140040 mitochondrial polycistronic RNA processing Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G23070

ath:AT3G25440

ath:AT3G27550

dosa:Os11g0592400

zma:100126360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.799

Rank 1 · LXL04_000772 · OH-1004

Plastid0.125

Rank 2 · LXL04_000772 · OH-1004

Nucleus0.074

Rank 3 · LXL04_000772 · OH-1004

Cytoplasm0.053

Rank 4 · LXL04_000772 · OH-1004

Cell membrane0.013

Rank 5 · LXL04_000772 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01985.27CRS1_YhbY166-250 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000772	`PF01985.27`	CRS1_YhbY	166	250	1.9e-15	57.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q67XL4`	Arabidopsis thaliana	Uncharacterized CRM domain-containing protein At3g25440, chloroplastic	57.208%	Swiss-Prot	strong database homology
`Q9LT57`	Arabidopsis thaliana	CRM-domain containing factor CFM9, mitochondrial	45.763%	Swiss-Prot	weak database homology
`F4J2U9`	Arabidopsis thaliana	CRM-domain containing factor CFM3A, chloroplastic/mitochondrial	37.158%	Swiss-Prot	weak database homology
`Q2R1U8`	Oryza sativa subsp. japonica	CRM-domain containing factor CFM3, chloroplastic/mitochondrial	35.196%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card