LXL04_000707 | RubberDandelionOmics

Gene overview

LXL04_000707

Reference: OH-1004 Chr: Chr01 Coordinates: 12981926-12983190 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

462 bp · LXL04_000707|LXL04_000707|OH1004|cDNA

ATGCGGTGCAAAGTGGAAGCAAAGACGCTTCCTCAAAACCCTAGAGCATCAGCCAAGGAAGCAGCGCAGCAGAAGCAGACTTTTAAGAGGAGGAATGGCGGACGCAACAAGCACGGCCGTGGTCACGTCAAGTTCATTCGCTGCTCTAACTGCGGCAAATGCTGTCCTAAGGACAAAGCTATCAAGAGATTTCTTGTGAGGAACATAGTGGAGCAGGCTGCTGTTAGGGATGTTCAAGAAGCTTGTGCTTTTGAGCAATA...

CDS

Download CDS FASTA

462 bp · LXL04_000707|LXL04_000707|OH1004|CDS

ATGCGGTGCAAAGTGGAAGCAAAGACGCTTCCTCAAAACCCTAGAGCATCAGCCAAGGAAGCAGCGCAGCAGAAGCAGACTTTTAAGAGGAGGAATGGCGGACGCAACAAGCACGGCCGTGGTCACGTCAAGTTCATTCGCTGCTCTAACTGCGGCAAATGCTGTCCTAAGGACAAAGCTATCAAGAGATTTCTTGTGAGGAACATAGTGGAGCAGGCTGCTGTTAGGGATGTTCAAGAAGCTTGTGCTTTTGAGCAATA...

Protein

Download Protein FASTA

153 aa · LXL04_000707|LXL04_000707|OH1004|PROTEIN

MRCKVEAKTLPQNPRASAKEAAQQKQTFKRRNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACAFEQYTLPKLYLKMQYCVSCAIHSKVVRVRSRVDRRNREPPKRFTRPRDDGPKPGQAPRAGGAAGPPPVRT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000707`
TK1151 ID	TkA01G592880
OH-1004 ID	LXL04_000707
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 83.660 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000707

Location Chr01:12981926-12983190 (-)

Description Similar to RPS26A: 40S ribosomal protein S26-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40590`	Small ribosomal subunit protein eS26y.	No verified direct reference in this release
`At2g40510`	Small ribosomal subunit protein eS26z.	No verified direct reference in this release
`At3g56340`	Small ribosomal subunit protein eS26x.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000707 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002181 cytoplasmic translation Biological Process

GO:0006412 translation Biological Process

GO:0008340 determination of adult lifespan Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0015935 small ribosomal subunit Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0022627 cytosolic small ribosomal subunit Cellular Component

GO:0098556 cytoplasmic side of rough endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT2G40510

ath:AT2G40590

ath:AT3G56340

cel:CELE_F39B2.6

spo:2542538

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.851

Rank 1 · LXL04_000707 · OH-1004

Nucleus0.244

Rank 2 · LXL04_000707 · OH-1004

Endoplasmic reticulum0.105

Rank 3 · LXL04_000707 · OH-1004

Mitochondrion0.030

Rank 4 · LXL04_000707 · OH-1004

Cell membrane0.014

Rank 5 · LXL04_000707 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01283.25Ribosomal_S26e27-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000707	`PF01283.25`	Ribosomal_S26e	27	128	3.8e-52	176.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P49206`	Arabidopsis thaliana	Small ribosomal subunit protein eS26y	81.250%	Swiss-Prot	strong database homology
`Q8LPJ7`	Arabidopsis thaliana	Small ribosomal subunit protein eS26z	80.357%	Swiss-Prot	strong database homology
`Q9LYK9`	Arabidopsis thaliana	Small ribosomal subunit protein eS26x	80.357%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card