LXL04_000699 | RubberDandelionOmics

Gene overview

LXL04_000699

Reference: OH-1004 Chr: Chr01 Coordinates: 12862274-12863560 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1287 bp · LXL04_000699|LXL04_000699|OH1004|cDNA

ATGGCCTCCTCGGCGGCCAATTCGTTATTCGGCAAGTATGACGTCGGAAAACTCCTCGGCTGCGGCGCTTTCGCTAAGGTGTACCATGCTAGGGATATCAAAAACGGTCACAGCGTTGCCATTAAGGTAATCAATAAGCATAAAATCTCTCATAACGCTCATCTCGTCTCGAACGTGAAGCGCGAGATCGAGATTATGCGCCGGCTCCGGCATCCGAACATTGTTAAATTGTATGAAGTTATGGCAACGAAGACCAAGAT...

CDS

Download CDS FASTA

1287 bp · LXL04_000699|LXL04_000699|OH1004|CDS

ATGGCCTCCTCGGCGGCCAATTCGTTATTCGGCAAGTATGACGTCGGAAAACTCCTCGGCTGCGGCGCTTTCGCTAAGGTGTACCATGCTAGGGATATCAAAAACGGTCACAGCGTTGCCATTAAGGTAATCAATAAGCATAAAATCTCTCATAACGCTCATCTCGTCTCGAACGTGAAGCGCGAGATCGAGATTATGCGCCGGCTCCGGCATCCGAACATTGTTAAATTGTATGAAGTTATGGCAACGAAGACCAAGAT...

Protein

Download Protein FASTA

428 aa · LXL04_000699|LXL04_000699|OH1004|PROTEIN

MASSAANSLFGKYDVGKLLGCGAFAKVYHARDIKNGHSVAIKVINKHKISHNAHLVSNVKREIEIMRRLRHPNIVKLYEVMATKTKIYFVMEFVKGGELFAKVAKGRLSESQSRKYFQQLISAIGYCHSRGVYHRDLKPENLLIDENGDLKVTDFGLSAVTGQIRADGLLHTLCGTPSYVAPEILTKRGYDGAKADIWSCGIILFVLNAAFLPFNDANLMIMYKKIYKGEYKCPKWMSSDLRRFLARILDTKPETRITVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000699`
TK1151 ID	TkA01G593060
OH-1004 ID	LXL04_000699
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000699

Location Chr01:12862274-12863560 (-)

Description Similar to CIPK11: CBL-interacting serine/threonine-protein kinase 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30360`	CIPK serine-threonine protein kinases interact with CBL proteins.	Arabidopsis protein kinase PKS5 inhibits the plasma membrane H+ -ATPase by preventing interaction with 14-3-3 protein.2007 · DOI: 10.1105/tpc.105.035626
`At5g01820`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`At4g18700`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`At1g29230`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0514200`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000699 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009268 response to pH Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009749 response to glucose Biological Process

GO:0019722 calcium-mediated signaling Biological Process

KEGG gene cross-reference

ath:AT1G29230

ath:AT2G30360

ath:AT4G18700

ath:AT5G01820

dosa:Os05g0514200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.533

Rank 1 · LXL04_000699 · OH-1004

Nucleus0.410

Rank 2 · LXL04_000699 · OH-1004

Cell membrane0.199

Rank 3 · LXL04_000699 · OH-1004

Golgi apparatus0.052

Rank 4 · LXL04_000699 · OH-1004

Lysosome / Vacuole0.049

Rank 5 · LXL04_000699 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase13-268 aa

PF07714.24PK_Tyr_Ser-Thr15-263 aa

PF01163.29RIO145-159 aa

PF03109.23ABC156-162 aa

PF14531.13Kinase-like114-245 aa

PF03822.21NAF295-353 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000699	`PF00069.32`	Pkinase	13	268	2.4e-74	250.8
LXL04_000699	`PF07714.24`	PK_Tyr_Ser-Thr	15	263	3.7e-39	135.3
LXL04_000699	`PF01163.29`	RIO1	45	159	4.2e-06	27.2
LXL04_000699	`PF03109.23`	ABC1	56	162	2e-08	34.4
LXL04_000699	`PF14531.13`	Kinase-like	114	245	1.4e-06	28.5
LXL04_000699	`PF03822.21`	NAF	295	353	7e-19	68.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22932`	Arabidopsis thaliana	CBL-interacting serine/threonine-protein kinase 11	63.725%	Swiss-Prot	strong database homology
`Q9LZW4`	Arabidopsis thaliana	CBL-interacting serine/threonine-protein kinase 14	57.176%	Swiss-Prot	strong database homology
`Q9SN43`	Arabidopsis thaliana	CBL-interacting serine/threonine-protein kinase 12	52.370%	Swiss-Prot	strong database homology
`Q9LP51`	Arabidopsis thaliana	CBL-interacting serine/threonine-protein kinase 18	53.515%	Swiss-Prot	strong database homology
`Q68Y49`	Oryza sativa subsp. japonica	CBL-interacting protein kinase 19	50.756%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card