LXL04_000638 | RubberDandelionOmics

Gene overview

LXL04_000638

Reference: OH-1004 Chr: Chr01 Coordinates: 11669373-11670698 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1137 bp · LXL04_000638|LXL04_000638|OH1004|cDNA

ATGTGTACCGTTGCGATCTCAAACTCGCCGGTGTTCTCACCGTCGTCAAGAGTTGCCTCTTCAATCTTCTGCAAATCGTCACCTGAATCTTTGACTTTGACCCACTCGCCGTCGGCGTCTTCCTCATCCCCAAAGTCGTCGTTCACGTTTCGACTTCAGAAACCATTGCCGCCTGCCAGTGGACTTATCAGAGCTTCCAACGACGATGGACCCACTTCTTGCTCTTCTACTTCTCCGACGATATTGAAGAGAAAACGACC...

CDS

Download CDS FASTA

1137 bp · LXL04_000638|LXL04_000638|OH1004|CDS

ATGTGTACCGTTGCGATCTCAAACTCGCCGGTGTTCTCACCGTCGTCAAGAGTTGCCTCTTCAATCTTCTGCAAATCGTCACCTGAATCTTTGACTTTGACCCACTCGCCGTCGGCGTCTTCCTCATCCCCAAAGTCGTCGTTCACGTTTCGACTTCAGAAACCATTGCCGCCTGCCAGTGGACTTATCAGAGCTTCCAACGACGATGGACCCACTTCTTGCTCTTCTACTTCTCCGACGATATTGAAGAGAAAACGACC...

Protein

Download Protein FASTA

378 aa · LXL04_000638|LXL04_000638|OH1004|PROTEIN

MCTVAISNSPVFSPSSRVASSIFCKSSPESLTLTHSPSASSSSPKSSFTFRLQKPLPPASGLIRASNDDGPTSCSSTSPTILKRKRPTRLAIPVAPLSFSADQSTPCVAAEDRWKEVEVEGDGYSVYCKRGKREVMEDRFKAMVDFNGENKQAFFGVFDGHGGSKAAEFAAENLGNNIQNEVEKSGEVEIVEAIKQSYLNTDAEFLKQEERGGTCCVTAVITSGNLVVSNAGDCRAVVSRGGAAEALTSDHRPSRADEKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000638`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000638

Location Chr01:11669373-11670698 (+)

Description Similar to At2g30020: Probable protein phosphatase 2C 25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30020`	Protein phosphatase that negatively regulates defense respones.	No verified direct reference in this release
`At1g07160`	Probable protein phosphatase 2C 2.	No verified direct reference in this release
`At2g40180`	Probable protein phosphatase 2C 30.	No verified direct reference in this release
`At1g67820`	Probable protein phosphatase 2C 14.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0292100`	Probable protein phosphatase 2C 32.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000638 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010440 stomatal lineage progression Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G07160

ath:AT1G67820

ath:AT2G30020

ath:AT2G40180

dosa:Os03g0292100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.440

Rank 1 · LXL04_000638 · OH-1004

Nucleus0.406

Rank 2 · LXL04_000638 · OH-1004

Cytoplasm0.160

Rank 3 · LXL04_000638 · OH-1004

Mitochondrion0.063

Rank 4 · LXL04_000638 · OH-1004

Cell membrane0.047

Rank 5 · LXL04_000638 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481.27PP2C124-367 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000638	`PF00481.27`	PP2C	124	367	1.2e-56	192.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80871`	Arabidopsis thaliana	Probable protein phosphatase 2C 25	58.500%	Swiss-Prot	strong database homology
`Q8RX37`	Arabidopsis thaliana	Probable protein phosphatase 2C 2	58.355%	Swiss-Prot	strong database homology
`Q9XEE8`	Arabidopsis thaliana	Probable protein phosphatase 2C 30	60.256%	Swiss-Prot	strong database homology
`Q9FXE4`	Arabidopsis thaliana	Probable protein phosphatase 2C 14	50.196%	Swiss-Prot	moderate database homology
`Q10MX1`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 32	48.329%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card