LXL04_000577 | RubberDandelionOmics

Gene overview

LXL04_000577

Reference: OH-1004 Chr: Chr01 Coordinates: 10473567-10474145 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

330 bp · LXL04_000577|LXL04_000577|OH1004|cDNA

ATGGAGCACTGCATGGACAAGAAATGGAAGCTATCGAAAGAAGATCCATGCAATCATTCGTCAAAATCGTCGTCGCTTTTAAGAAGCATTTCACAAAAAACCTCAACGAAATCGCCTCTTTTGAGATCGTTTTCGCAAAAGAGTAGTTCGAACCCTAAATCGTCGTTTTTTTCGAGAAGCTCGTCGCAAAAGCATAAGTGTACGCCGTCGGATCTGTCGAGAAGTTCGTCTCAAAAATGTGCGAACTTCACACGGAAATG...

CDS

Download CDS FASTA

330 bp · LXL04_000577|LXL04_000577|OH1004|CDS

ATGGAGCACTGCATGGACAAGAAATGGAAGCTATCGAAAGAAGATCCATGCAATCATTCGTCAAAATCGTCGTCGCTTTTAAGAAGCATTTCACAAAAAACCTCAACGAAATCGCCTCTTTTGAGATCGTTTTCGCAAAAGAGTAGTTCGAACCCTAAATCGTCGTTTTTTTCGAGAAGCTCGTCGCAAAAGCATAAGTGTACGCCGTCGGATCTGTCGAGAAGTTCGTCTCAAAAATGTGCGAACTTCACACGGAAATG...

Protein

Download Protein FASTA

109 aa · LXL04_000577|LXL04_000577|OH1004|PROTEIN

MEHCMDKKWKLSKEDPCNHSSKSSSLLRSISQKTSTKSPLLRSFSQKSSSNPKSSFFSRSSSQKHKCTPSDLSRSSSQKCANFTRKCGSLAKEQKARFYIVKRCVTMLI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000577`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000577

Location Chr01:10473567-10474145 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59510`	Small polypeptide acting as a regulatory molecule which coordinates cellular responses required for differentiation, growth and development, probably by restricting polar cell proliferation in lateral organs and coordinating socket cell recruitment and differentiation at trichome sites.	No verified direct reference in this release
`At3g55515`	Small polypeptide acting as a regulatory molecule which coordinates cellular responses required for differentiation, growth and development, probably by restricting polar cell proliferation in lateral organs and coordinating socket cell recruitment and differentiation at trichome sites.	No verified direct reference in this release
`At2g39705`	Small polypeptide acting as a regulatory molecule which coordinates cellular responses required for differentiation, growth and development, probably by restricting polar cell proliferation in lateral organs and coordinating socket cell recruitment and differentiation at trichome sites.	No verified direct reference in this release
`At1g53708`	Small polypeptide acting as a regulatory molecule which coordinates cellular responses required for differentiation, growth and development, probably by restricting polar cell proliferation in lateral organs and coordinating socket cell recruitment and differentiation at trichome sites.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000577 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0048367 shoot system development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G53708

ath:AT2G39705

ath:AT3G55515

ath:AT5G59510

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.481

Rank 1 · LXL04_000577 · OH-1004

Nucleus0.401

Rank 2 · LXL04_000577 · OH-1004

Cell membrane0.209

Rank 3 · LXL04_000577 · OH-1004

Endoplasmic reticulum0.067

Rank 4 · LXL04_000577 · OH-1004

Mitochondrion0.049

Rank 5 · LXL04_000577 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08137.18DVL92-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000577	`PF08137.18`	DVL	92	109	5.6e-11	42.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LE84`	Arabidopsis thaliana	Small polypeptide DEVIL 18	48.958%	Swiss-Prot	moderate database homology
`Q6IM93`	Arabidopsis thaliana	Small polypeptide DEVIL 8	66.667%	Swiss-Prot	weak database homology
`Q8S8S3`	Arabidopsis thaliana	Small polypeptide DEVIL 11	70.968%	Swiss-Prot	weak database homology
`F4HTB2`	Arabidopsis thaliana	Small polypeptide DEVIL 22	69.231%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card