LXL04_000571 | RubberDandelionOmics

Gene overview

LXL04_000571

Reference: OH-1004 Chr: Chr01 Coordinates: 10421953-10422870 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

918 bp · LXL04_000571|LXL04_000571|OH1004|cDNA

ATGGGAGAGAAAGTGAGAATCACCGGCTACGATGTCGGTGGCGGTGATGACGACGAGGGTCGAGTTTTGGAGTGGGAGGCGGGGTTGCCGAACATAGATGATTTGACGCCGTTATCGCAGTCGATGATCTCTGCGGATTTCTTGTCGGCGTTCAGTATCAGGCCGGAGCCTTACCGGAGTTTGTGTGACGTCAATCGTGCTTCTCAGAACACGCTTTCGAATCTCCGAGGGGAGTCGGAACAACAGTCGGTGAACAAATT...

CDS

Download CDS FASTA

918 bp · LXL04_000571|LXL04_000571|OH1004|CDS

ATGGGAGAGAAAGTGAGAATCACCGGCTACGATGTCGGTGGCGGTGATGACGACGAGGGTCGAGTTTTGGAGTGGGAGGCGGGGTTGCCGAACATAGATGATTTGACGCCGTTATCGCAGTCGATGATCTCTGCGGATTTCTTGTCGGCGTTCAGTATCAGGCCGGAGCCTTACCGGAGTTTGTGTGACGTCAATCGTGCTTCTCAGAACACGCTTTCGAATCTCCGAGGGGAGTCGGAACAACAGTCGGTGAACAAATT...

Protein

Download Protein FASTA

305 aa · LXL04_000571|LXL04_000571|OH1004|PROTEIN

MGEKVRITGYDVGGGDDDEGRVLEWEAGLPNIDDLTPLSQSMISADFLSAFSIRPEPYRSLCDVNRASQNTLSNLRGESEQQSVNKFNSSKSFGDDIGDEMVVEDEETTDLTRDASDLQNLQRLDDGGDGGVAGEEIDSALLADDPSARASKRARLAWTPQLHKRFVDVVAHLGVKNAVPKTIMQWMNVEGLTRENVASHLQKYRLYLKRMHIQSPSSTQVPQNLHESGSGAAHGHHHASGAIPMHYPPQMVPMPYQSPQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000571`
TK1151 ID	TkA01G602290
OH-1004 ID	LXL04_000571
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	69.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000571

Location Chr01:10421953-10422870 (+)

Description Similar to LUX: Transcription factor LUX

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46640`	Transcription factor that is essential for the generation of the circadian clock oscillation.	PHYTOCLOCK 1 encoding a novel GARP protein essential for the Arabidopsis circadian clock.2005 · DOI: 10.1111/j.1365-2443.2005.00892.x LUX ARRHYTHMO encodes a nighttime repressor of circadian gene expression in the Arabidopsis core clock.2011 · DOI: 10.1016/j.cub.2010.12.021
`At5g59570`	Transcription factor that is a critical component of the regulatory circuit of the circadian clock.	No verified direct reference in this release
`At2g40970`	Probable transcription factor that acts as a negative regulator of freezing tolerance via a CBF-independent pathway.	A single-repeat R3-MYB transcription factor MYBC1 negatively regulates freezing tolerance in Arabidopsis.2010 · DOI: 10.1016/j.bbrc.2010.03.114

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0796500`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release
`UniProt: B8AEH1`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000571 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009409 response to cold Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0042753 positive regulation of circadian rhythm Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G40970

ath:AT3G46640

ath:AT5G59570

dosa:Os02g0796500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.982

Rank 1 · LXL04_000571 · OH-1004

Cytoplasm0.082

Rank 2 · LXL04_000571 · OH-1004

Cell membrane0.020

Rank 3 · LXL04_000571 · OH-1004

Endoplasmic reticulum0.013

Rank 4 · LXL04_000571 · OH-1004

Plastid0.009

Rank 5 · LXL04_000571 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding155-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000571	`PF00249.38`	Myb_DNA-binding	155	205	1.3e-07	32.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SNB4`	Arabidopsis thaliana	Transcription factor LUX	45.763%	Swiss-Prot	moderate database homology
`Q9LTH4`	Arabidopsis thaliana	Transcription factor BOA	54.592%	Swiss-Prot	moderate database homology
`O22210`	Arabidopsis thaliana	Transcription factor MYBC1	54.098%	Swiss-Prot	weak database homology
`Q6K8X6`	Oryza sativa subsp. japonica	Two-component response regulator ORR23	35.088%	Swiss-Prot	moderate database homology
`B8AEH1`	Oryza sativa subsp. indica	Two-component response regulator ORR23	35.088%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card