LXL04_000542 | RubberDandelionOmics

Gene overview

LXL04_000542

Reference: OH-1004 Chr: Chr01 Coordinates: 10067669-10068891 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1020 bp · LXL04_000542|LXL04_000542|OH1004|cDNA

ATGGTTTTCTCATCTGTTCCACCCTATCTGGATCACCACAATTGGCATCTCCAGTTGCAACAATCAAACCATCAACAAGCAAGTGTTCATGGAGGTGGCGAAAACCCTAGTctcccaccaccacctccaccgccACAACCTGGCGGCGGGTCTGCAGGCAGTGGTGGTGCCAACGGAGAAGGTTCCATCAGACCAGGATCCATGGTAGATCGAGCAAGAATAGCGAGGCTACCCATGCCGGAGCCAGGATTAAACTGCCC...

CDS

Download CDS FASTA

1020 bp · LXL04_000542|LXL04_000542|OH1004|CDS

ATGGTTTTCTCATCTGTTCCACCCTATCTGGATCACCACAATTGGCATCTCCAGTTGCAACAATCAAACCATCAACAAGCAAGTGTTCATGGAGGTGGCGAAAACCCTAGTCTCCCACCACCACCTCCACCGCCACAACCTGGCGGCGGGTCTGCAGGCAGTGGTGGTGCCAACGGAGAAGGTTCCATCAGACCAGGATCCATGGTAGATCGAGCAAGAATAGCGAGGCTACCCATGCCGGAGCCAGGATTAAACTGCCC...

Protein

Download Protein FASTA

339 aa · LXL04_000542|LXL04_000542|OH1004|PROTEIN

MVFSSVPPYLDHHNWHLQLQQSNHQQASVHGGGENPSLPPPPPPPQPGGGSAGSGGANGEGSIRPGSMVDRARIARLPMPEPGLNCPRCDSTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRNNKNRSSKSPSQPGGLKSVGDQSPSRCSTETMASTQLPHPPSLQLPFMGQYGGGVGGNIGGFQSQNEMGNFQLGSGSSTGNNFNNILSIGGVENWRLPFMAGFEVPSNSNLFHYQTQSTEGH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000542`
TK1151 ID	TkA01G603240
OH-1004 ID	LXL04_000542
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000542

Location Chr01:10067669-10068891 (+)

Description Similar to DOF3.6: Dof zinc finger protein DOF3.6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55370`	Transcription factor that binds specifically to a 5'-AA[AG]G- 3' consensus core sequence.	Target genes for OBP3, a Dof transcription factor, include novel basic helix-loop-helix domain proteins inducible by salicylic acid.2003 · DOI: 10.1046/j.1365-313x.2003.01812.x
`At2g37590`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity).	Sequential activation of two Dof transcription factor gene promoters during vascular development in Arabidopsis thaliana.2007 · DOI: 10.1016/j.plaphy.2007.05.001 Mobile PEAR transcription factors integrate positional cues to prime cambial growth.2019 · DOI: 10.1038/s41586-018-0839-y
`At5g02460`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity).	The DOF transcription factor Dof5.1 influences leaf axial patterning by promoting Revoluta transcription in Arabidopsis.2010 · DOI: 10.1111/j.1365-313x.2010.04346.x Mobile PEAR transcription factors integrate positional cues to prime cambial growth.2019 · DOI: 10.1038/s41586-018-0839-y
`At1g07640`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	DOF transcription factor AtDof1.1 (OBP2) is part of a regulatory network controlling glucosinolate biosynthesis in Arabidopsis.2006 · DOI: 10.1111/j.1365-313x.2006.02767.x Mobile PEAR transcription factors integrate positional cues to prime cambial growth.2019 · DOI: 10.1038/s41586-018-0839-y
`At2g28810`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000542 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0003002 regionalization Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009611 response to wounding Biological Process

GO:0009625 response to insect Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009944 polarity specification of adaxial/abaxial axis Biological Process

GO:0010439 regulation of glucosinolate biosynthetic process Biological Process

GO:0010497 plasmodesmata-mediated intercellular transport Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0090057 root radial pattern formation Biological Process

KEGG gene cross-reference

ath:AT1G07640

ath:AT2G28810

ath:AT2G37590

ath:AT3G55370

ath:AT5G02460

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.972

Rank 1 · LXL04_000542 · OH-1004

Cytoplasm0.111

Rank 2 · LXL04_000542 · OH-1004

Cell membrane0.022

Rank 3 · LXL04_000542 · OH-1004

Endoplasmic reticulum0.014

Rank 4 · LXL04_000542 · OH-1004

Plastid0.009

Rank 5 · LXL04_000542 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02701.21Zn_ribbon_Dof84-138 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000542	`PF02701.21`	Zn_ribbon_Dof	84	138	1.9e-32	111.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2U1`	Arabidopsis thaliana	Dof zinc finger protein DOF3.6	59.459%	Swiss-Prot	weak database homology
`O80928`	Arabidopsis thaliana	Dof zinc finger protein DOF2.4	63.889%	Swiss-Prot	weak database homology
`Q9LZ56`	Arabidopsis thaliana	Dof zinc finger protein DOF5.1	57.047%	Swiss-Prot	weak database homology
`Q8L9V6`	Arabidopsis thaliana	Dof zinc finger protein DOF1.1	46.305%	Swiss-Prot	moderate database homology
`Q9ZV33`	Arabidopsis thaliana	Dof zinc finger protein DOF2.2	35.246%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card