LXL04_000533 | RubberDandelionOmics

Gene overview

LXL04_000533

Reference: OH-1004 Chr: Chr01 Coordinates: 9920882-9921612 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

586 bp · LXL04_000533|LXL04_000533|OH1004|cDNA

ATCATCCATCTCAGGTCCCCGCCTGCCCGCCATCCACCTCTACATTAACCAAACCATGTGAAAATGTGTAATTACCGATACCCGAACAATCAGCTCATTCTATCACCGTTACTGCGACGCTACAGAGAAGATGGACGCCGCCGGAAAAGCTAAGAAAGGTGCCGGAGGAAGAAAGGGAGGCGGTCCAAGGAAGAAGGCGGTTTCCCGTTCTGTCAAAGCCGGACTTCAGTTTCCCGTTGGTAGGATCGGACGTTACCTAA...

CDS

Download CDS FASTA

456 bp · LXL04_000533|LXL04_000533|OH1004|CDS

ATGGACGCCGCCGGAAAAGCTAAGAAAGGTGCCGGAGGAAGAAAGGGAGGCGGTCCAAGGAAGAAGGCGGTTTCCCGTTCTGTCAAAGCCGGACTTCAGTTTCCCGTTGGTAGGATCGGACGTTACCTAAAGAAAGGCAGGTATGCTAAGCGAGTCGGAACAGGTGCTCCGGTTTACCTCGCCGCTGTCCTTGAATACCTTGCAGCTGAAGTGTTGGAGTTGGCCGGAAATGCGGCTAGGGACAACAAGAAGACGAGAAT...

Protein

Download Protein FASTA

151 aa · LXL04_000533|LXL04_000533|OH1004|PROTEIN

MDAAGKAKKGAGGRKGGGPRKKAVSRSVKAGLQFPVGRIGRYLKKGRYAKRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIIPRHLLLAIRNDEELGKLLGGVTIAHGGVLPNINPILLPKKTAAKEPASPSKATKSPKKAKKAE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000533`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000533

Location Chr01:9920882-9921612 (-)

Description Similar to Histone H2A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02560`	Core component of nucleosome.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000533 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0031507 heterochromatin formation Biological Process

GO:0070828 heterochromatin organization Biological Process

GO:0000775 chromosome, centromeric region Cellular Component

GO:0000786 nucleosome Cellular Component

GO:0000792 heterochromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003682 chromatin binding Molecular Function

GO:0030527 structural constituent of chromatin Molecular Function

GO:0046982 protein heterodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT5G02560

mtr:11418081

sly:101250163

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.971

Rank 1 · LXL04_000533 · OH-1004

Cytoplasm0.067

Rank 2 · LXL04_000533 · OH-1004

Extracellular0.015

Rank 3 · LXL04_000533 · OH-1004

Cell membrane0.013

Rank 4 · LXL04_000533 · OH-1004

Endoplasmic reticulum0.009

Rank 5 · LXL04_000533 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00125.31Histone21-97 aa

PF16211.11Histone_H2A_C100-132 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000533	`PF00125.31`	Histone	21	97	1.5e-11	45.2
LXL04_000533	`PF16211.11`	Histone_H2A_C	100	132	2.1e-18	66.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZ46`	Arabidopsis thaliana	Probable histone H2A.4	81.699%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card