LXL04_000096 | RubberDandelionOmics

Gene overview

LXL04_000096

Reference: OH-1004 Chr: Chr01 Coordinates: 2222195-2222971 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

444 bp · LXL04_000096|LXL04_000096|OH1004|cDNA

ATGGGACTTTGCTTCTCTTCGGCGAGTTTATGTTGCTTCACTGGGACGGAAGAAGATGAACCAGATGAACGACCCCACCTTGCAGGAGGTAAAGTGACACTTGTCACCACCAAAGATGTGTGGGACCGAAAGCTCTCTGAAGCAAAAACACAAGGCAAAATAGTGGTTGCCAACTTTAGTGCATCTTGGTGTGGTCCTTGCAAGTCAATTGGTCCATTATACATTGAACTTTCAGAAAAGCATCTTTCTCTTATGTTTCT...

CDS

Download CDS FASTA

444 bp · LXL04_000096|LXL04_000096|OH1004|CDS

ATGGGACTTTGCTTCTCTTCGGCGAGTTTATGTTGCTTCACTGGGACGGAAGAAGATGAACCAGATGAACGACCCCACCTTGCAGGAGGTAAAGTGACACTTGTCACCACCAAAGATGTGTGGGACCGAAAGCTCTCTGAAGCAAAAACACAAGGCAAAATAGTGGTTGCCAACTTTAGTGCATCTTGGTGTGGTCCTTGCAAGTCAATTGGTCCATTATACATTGAACTTTCAGAAAAGCATCTTTCTCTTATGTTTCT...

Protein

Download Protein FASTA

147 aa · LXL04_000096|LXL04_000096|OH1004|PROTEIN

MGLCFSSASLCCFTGTEEDEPDERPHLAGGKVTLVTTKDVWDRKLSEAKTQGKIVVANFSASWCGPCKSIGPLYIELSEKHLSLMFLMVDVDALTEFSAQWDIKATPTFFFLREGKQFDKVVGANKQELENKINSVVVVSQPPAAQK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000096`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000096

Location Chr01:2222195-2222971 (-)

Description Similar to Thioredoxin H-type

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g08710`	Probable thiol-disulfide oxidoreductase that may play a role in intercellular communication due to its ability to move from cell to cell.	No verified direct reference in this release
`At3g56420`	Probable thiol-disulfide oxidoreductase that may be involved in the redox regulation of a number of cytosolic enzymes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0169000`	Probable thiol-disulfide oxidoreductase that may be involved in the redox regulation of a number of cytosolic enzymes.	No verified direct reference in this release
`Os01g0168200`	Probable thiol-disulfide oxidoreductase that may be involved in the redox regulation of a number of cytosolic enzymes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000096 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007154 cell communication Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT3G08710

ath:AT3G56420

dosa:Os01g0168200

dosa:Os05g0169000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.477

Rank 1 · LXL04_000096 · OH-1004

Nucleus0.247

Rank 2 · LXL04_000096 · OH-1004

Cell membrane0.207

Rank 3 · LXL04_000096 · OH-1004

Endoplasmic reticulum0.187

Rank 4 · LXL04_000096 · OH-1004

Golgi apparatus0.171

Rank 5 · LXL04_000096 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00085.27Thioredoxin33-134 aa

PF13098.14Thioredoxin_242-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000096	`PF00085.27`	Thioredoxin	33	134	6.5e-22	78.2
LXL04_000096	`PF13098.14`	Thioredoxin_2	42	128	5.8e-09	37.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9Y6`	Arabidopsis thaliana	Thioredoxin H9	57.664%	Swiss-Prot	strong database homology
`Q9LXZ8`	Arabidopsis thaliana	Putative thioredoxin H10	47.664%	Swiss-Prot	moderate database homology
`Q0DKF1`	Oryza sativa subsp. japonica	Thioredoxin H4-2	57.500%	Swiss-Prot	strong database homology
`Q9AS75`	Oryza sativa subsp. japonica	Thioredoxin H4-1	52.500%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card