LXL04_000093 | RubberDandelionOmics

Gene overview

LXL04_000093

Reference: OH-1004 Chr: Chr01 Coordinates: 2191318-2193187 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

755 bp · LXL04_000093|LXL04_000093|OH1004|cDNA

CGGTAACAGTGAATGATTACCTTGCTCAACGTGATGCTGAGTGGATGGGTCGTGTTCATCACTTCTTAGGTCTGTCTGTTGGTCTTATTCAAGAACTTGGTTTTGATTATTTGAGAGAAAATCTTGCTGGAAGCAGTGGACAACTTGTTATGAGATGGCCAAAACCATTCCATTTTGCAATAGTTGATGAAGTTGATTCAGTCCTAATTGATGAGGGAAGAAACCCTTTGCTAATAAGTGGTGAGGCTAGCAAGGATGCA...

CDS

Download CDS FASTA

696 bp · LXL04_000093|LXL04_000093|OH1004|CDS

ATGGGTCGTGTTCATCACTTCTTAGGTCTGTCTGTTGGTCTTATTCAAGAACTTGGTTTTGATTATTTGAGAGAAAATCTTGCTGGAAGCAGTGGACAACTTGTTATGAGATGGCCAAAACCATTCCATTTTGCAATAGTTGATGAAGTTGATTCAGTCCTAATTGATGAGGGAAGAAACCCTTTGCTAATAAGTGGTGAGGCTAGCAAGGATGCAGCACGTTATCCAGTTGCTGCCAAAGTAGCCGAGCTTCTCATACG...

Protein

Download Protein FASTA

231 aa · LXL04_000093|LXL04_000093|OH1004|PROTEIN

MGRVHHFLGLSVGLIQELGFDYLRENLAGSSGQLVMRWPKPFHFAIVDEVDSVLIDEGRNPLLISGEASKDAARYPVAAKVAELLIRGLLKDNSVELTEEGITLAEMALETKDLWDENDPWARVEEKRRWSEGIHQAVEAKESLQIQADSVVVAQITYQSMFKLYPKLSGMTGTAKTEMPVIEVPTNMANIRNDLPIQAFATARGKWEYVRAEVESMFRIGRPVLVGTTRY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000093`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000093

Location Chr01:2191318-2193187 (+)

Description Similar to SECA2: Protein translocase subunit SECA2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21650`	Involved in protein export.	Plastids contain a second sec translocase system with essential functions.2011 · DOI: 10.1104/pp.110.166546

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000093 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006605 protein targeting Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0017038 protein import Biological Process

GO:0065002 intracellular protein transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

KEGG gene cross-reference

ath:AT1G21650

cyb:CYB_2451

cyc:PCC7424_0032

cyn:Cyan7425_3658

gvi:gll1836

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.471

Rank 1 · LXL04_000093 · OH-1004

Nucleus0.277

Rank 2 · LXL04_000093 · OH-1004

Plastid0.135

Rank 3 · LXL04_000093 · OH-1004

Extracellular0.088

Rank 4 · LXL04_000093 · OH-1004

Peroxisome0.078

Rank 5 · LXL04_000093 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07517.21SecA_DEAD16-178 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000093	`PF07517.21`	SecA_DEAD	16	178	1.2e-37	130.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`D8WUA4`	Arabidopsis thaliana	Protein translocase subunit SECA2, chloroplastic	65.886%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card