LXL04_000006 | RubberDandelionOmics

Gene overview

LXL04_000006

Reference: OH-1004 Chr: Chr01 Coordinates: 117256-119801 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2451 bp · LXL04_000006|LXL04_000006|OH1004|cDNA

ATGCTTCTCTTCATGGAAATCAGTCTGGGCTCTTTGAGTCGTTTTCACAAACACCTGCAGTGCACAAACGAGCTAAAATCAGCCAACAATACAGAACATCGAAGCCGTTTGTGTATTCACAGTGCACTTTTTTTCCTTACTCTTCTGATTCTATCTTGTCATCACGTTTCAGGTAAATCGTCCGACGAGGAGATCGCGGTCACGCTTTCAGATTATACAGCTCTTCAATCCATCAAACAGGATCTCGTTGATTTCAGAGG...

CDS

Download CDS FASTA

2451 bp · LXL04_000006|LXL04_000006|OH1004|CDS

ATGCTTCTCTTCATGGAAATCAGTCTGGGCTCTTTGAGTCGTTTTCACAAACACCTGCAGTGCACAAACGAGCTAAAATCAGCCAACAATACAGAACATCGAAGCCGTTTGTGTATTCACAGTGCACTTTTTTTCCTTACTCTTCTGATTCTATCTTGTCATCACGTTTCAGGTAAATCGTCCGACGAGGAGATCGCGGTCACGCTTTCAGATTATACAGCTCTTCAATCCATCAAACAGGATCTCGTTGATTTCAGAGG...

Protein

Download Protein FASTA

816 aa · LXL04_000006|LXL04_000006|OH1004|PROTEIN

MLLFMEISLGSLSRFHKHLQCTNELKSANNTEHRSRLCIHSALFFLTLLILSCHHVSGKSSDEEIAVTLSDYTALQSIKQDLVDFRGVLRTWKDRNAVCSGGWIGIKCDQGQVIAIQLPWKGLGGTISSKLGNLKSLRRISLHDNVLAGPIPQSLWLLPNLRGVYLFNNRLSGSIPPSIAQSPSLQNLDLSNNALNGTIPHIFSNSSKIYRFNLSHNAFSGSIPSSFTLLPSLTFLALEHNNLSGSIPDTWSSGQLSSLT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000006`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000006

Location Chr01:117256-119801 (-)

Description Similar to IMK3: Probable leucine-rich repeat receptor-like protein kinase IMK3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56100`	Can phosphorylate AGL24.	No verified direct reference in this release
`At3g51740`	Probably inactive leucine-rich repeat receptor-like protein kinase IMK2.	No verified direct reference in this release
`At2g26730`	Probable inactive receptor kinase At2g26730.	No verified direct reference in this release
`At3g08680`	Probable inactive receptor kinase At3g08680.	No verified direct reference in this release
`At5g58300`	Probable inactive receptor kinase At5g58300.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000006 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G26730

ath:AT3G08680

ath:AT3G51740

ath:AT3G56100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.880

Rank 1 · LXL04_000006 · OH-1004

Endoplasmic reticulum0.088

Rank 2 · LXL04_000006 · OH-1004

Cytoplasm0.063

Rank 3 · LXL04_000006 · OH-1004

Nucleus0.050

Rank 4 · LXL04_000006 · OH-1004

Lysosome / Vacuole0.022

Rank 5 · LXL04_000006 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_270-109 aa

PF12799.14LRR_4159-195 aa

PF13855.13LRR_8183-243 aa

PF13855.13LRR_8255-314 aa

PF23598.2LRR_14304-393 aa

PF13855.13LRR_8324-384 aa

PF00069.32Pkinase524-788 aa

PF07714.24PK_Tyr_Ser-Thr525-790 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000006	`PF08263.18`	LRRNT_2	70	109	6.4e-06	27.1
LXL04_000006	`PF12799.14`	LRR_4	159	195	6.1e-21	74.7
LXL04_000006	`PF13855.13`	LRR_8	183	243	1.4e-32	111.9
LXL04_000006	`PF13855.13`	LRR_8	255	314	1.4e-32	111.9
LXL04_000006	`PF23598.2`	LRR_14	304	393	7.6e-10	38.8
LXL04_000006	`PF13855.13`	LRR_8	324	384	1.4e-32	111.9
LXL04_000006	`PF00069.32`	Pkinase	524	788	2.9e-38	132.5
LXL04_000006	`PF07714.24`	PK_Tyr_Ser-Thr	525	790	1.1e-38	133.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGP9`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase IMK3	58.732%	Swiss-Prot	strong database homology
`Q9SCT4`	Arabidopsis thaliana	Probably inactive leucine-rich repeat receptor-like protein kinase IMK2	62.127%	Swiss-Prot	strong database homology
`O48788`	Arabidopsis thaliana	Probable inactive receptor kinase At2g26730	37.600%	Swiss-Prot	moderate database homology
`Q9C9Y8`	Arabidopsis thaliana	Probable inactive receptor kinase At3g08680	39.539%	Swiss-Prot	moderate database homology
`Q9LVM0`	Arabidopsis thaliana	Probable inactive receptor kinase At5g58300	40.402%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card