Gene Card
Gene overview
cDNA / CDS / Protein Sequences
402 bp · TkAUNG053780|TK1151|cDNA
ATGGGGATATGCTTGTCAGCGGAATCGCCGCCTAGGAAAAACCATTCAAAACGCGTCACAAATCAGTCAACTACATCAAGCAATACCAATTCAAGCAATCGATGGTCTCGCGTTCGATCTCTGTCTAGCAGAAGAGAAAAATTCGACGATGCTATGATTCATGAACATACAATCGCTGCCGCTCTGCTTTTCCAGCAACACCAGCAGCAAAATGGCGGTGTTTCGCCTTCTGATCGATCAACTTCTCTCCGGCATCTACC...
402 bp · TkAUNG053780|TK1151|CDS
ATGGGGATATGCTTGTCAGCGGAATCGCCGCCTAGGAAAAACCATTCAAAACGCGTCACAAATCAGTCAACTACATCAAGCAATACCAATTCAAGCAATCGATGGTCTCGCGTTCGATCTCTGTCTAGCAGAAGAGAAAAATTCGACGATGCTATGATTCATGAACATACAATCGCTGCCGCTCTGCTTTTCCAGCAACACCAGCAGCAAAATGGCGGTGTTTCGCCTTCTGATCGATCAACTTCTCTCCGGCATCTACC...
Protein
Download Protein FASTA133 aa · TkAUNG053780|TK1151|PROTEIN
MGICLSAESPPRKNHSKRVTNQSTTSSNTNSSNRWSRVRSLSSRREKFDDAMIHEHTIAAALLFQQHQQQNGGVSPSDRSTSLRHLPGSTNSKRHYPLPQSSSTRPRSVADPLLPPQRLLNQVWLPTLITRFD
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG053780 |
|---|---|
| TK1151 ID | TkAUNG053780 |
| OH-1004 ID | LXL04_006507 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 92.600 |
| Protein coverage (%) | TK1151 91.729 / OH-1004 31.854Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG053780 |
|---|---|
| Location | ChrUn:15373952-15374353 (-) |
| Description | Similar to MES11: Putative methylesterase 11, chloroplastic |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0009694 jasmonic acid metabolic process Biological Process GO:0009696 salicylic acid metabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0080030 methyl indole-3-acetate esterase activity Molecular Function GO:0080031 methyl salicylate esterase activity Molecular Function GO:0080032 methyl jasmonate esterase activity Molecular Function |
| KEGG gene cross-reference | ath:AT1G26360 ath:AT1G33990 ath:AT1G69240 ath:AT3G29770 ath:AT4G09900 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.