TkAUNG000100 | RubberDandelionOmics

Gene overview

TkAUNG000100

Reference: TK1151 Chr: ChrUn Coordinates: 41094-42316 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

987 bp · TkAUNG000100|TK1151|cDNA

TATCATAAAAGGAGACTTGCTCCAGTAGTGAACGAAGACCTATAATTTCTTATAGAATTAAACGTCAAGGGCATCATCATCATAATTTTTAGAACAAATGGGGCTGTTCTCGAACAGATTGGACAGGGGGAGTCTAAAACCAGGAGATCATATATATTCATGGCGTGCTGCTTATATATACGCTCATCACGGTATCTATGTTGGTGATGAGAAAGTGATTCATTTCACAAGAACCGGTCAAAAAACAGGAACAAGTTCAG...

CDS

Download CDS FASTA

744 bp · TkAUNG000100|TK1151|CDS

ATGGGGCTGTTCTCGAACAGATTGGACAGGGGGAGTCTAAAACCAGGAGATCATATATATTCATGGCGTGCTGCTTATATATACGCTCATCACGGTATCTATGTTGGTGATGAGAAAGTGATTCATTTCACAAGAACCGGTCAAAAAACAGGAACAAGTTCAGTCCTCGATGTGCTCATGGTCAGCTCAGCCCCACCGCCATCTCTGATCCCATGTCCCAACTGCCCTCCTACCAACAATACCAGCGGAGTCATCTCCTC...

Protein

Download Protein FASTA

247 aa · TkAUNG000100|TK1151|PROTEIN

MGLFSNRLDRGSLKPGDHIYSWRAAYIYAHHGIYVGDEKVIHFTRTGQKTGTSSVLDVLMVSSAPPPSLIPCPNCPPTNNTSGVISSCLDCFLAGGVLYRYEYSTNPAIFLAKPLDATCTLAAADPPETVVFRANFLLLNGFGCYNLFKNNCQDFAIYCKTSLLVSNKKSMSQNAHAASIFGKSVTGVVSAMLKFASMNIYVKTASGVASGVVTHFVSRYAYDIGIRSDVIKVSVEDVVQTHHKKAP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG000100`
TK1151 ID	TkAUNG000100
OH-1004 ID	LXL04_014432
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG000100

Location ChrUn:41094-42316 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06370`	May participate in lead-ion stress responses and phytochelatin-related metabolism.	The PSE1 gene modulates lead tolerance in Arabidopsis.2016 · DOI: 10.1093/jxb/erw251

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014432 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010288 response to lead ion Biological Process

GO:0015692 lead ion transport Biological Process

GO:0046938 phytochelatin biosynthetic process Biological Process

GO:0071284 cellular response to lead ion Biological Process

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT5G06370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.257

Rank 1 · TkAUNG000100 · TK1151

Cytoplasm0.246

Rank 2 · TkAUNG000100 · TK1151

Lysosome / Vacuole0.165

Rank 3 · TkAUNG000100 · TK1151

Mitochondrion0.128

Rank 4 · TkAUNG000100 · TK1151

Nucleus0.127

Rank 5 · TkAUNG000100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00877NLPC_P6010-55 aa

PF04970LRAT13-163 aa

PF05903Peptidase_C97145-163 aa

PF00877NLPC_P60151-187 aa

PF05903Peptidase_C97173-212 aa

PF04970LRAT220-220 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG000100	`PF00877`	NLPC_P60	10	55	0.017	15.8
TkAUNG000100	`PF04970`	LRAT	13	163	2e-26	93.4
TkAUNG000100	`PF05903`	Peptidase_C97	145	163	1.7	9.2
TkAUNG000100	`PF00877`	NLPC_P60	151	187	0.017	15.8
TkAUNG000100	`PF05903`	Peptidase_C97	173	212	1.7	9.2
TkAUNG000100	`PF04970`	LRAT	220	220	2e-26	93.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93V51`	Arabidopsis thaliana	sp\|Q93V51\|PSE1_ARATH Protein LEAD-SENSITIVE 1	58.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card