TkAUNG000080 | RubberDandelionOmics

Gene overview

TkAUNG000080

Reference: TK1151 Chr: ChrUn Coordinates: 22628-29341 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1548 bp · TkAUNG000080|TK1151|cDNA

ATGCTGCGGCTAGATGATGTGATTTCGCTGTCCTTCTGTGTTGGTCTCAGACATTTTACTCTTCATGCATATCCATTTAGAAAGGGTTCATGCCCTTTTATGAAAAGTGGGAGAAGTCGGAAGGACTTTCGCTTTTTTGCTTCCACCACAGAAGATGCAATTCAGTGGGTCAATGCATTTGCAGATCAGCAGTGCTATGTAAATTGCTTGCCTCACCCTATGGCTTCTAATAATCAGAGTTCAGATACGATTTTCAGTGA...

CDS

Download CDS FASTA

1548 bp · TkAUNG000080|TK1151|CDS

ATGCTGCGGCTAGATGATGTGATTTCGCTGTCCTTCTGTGTTGGTCTCAGACATTTTACTCTTCATGCATATCCATTTAGAAAGGGTTCATGCCCTTTTATGAAAAGTGGGAGAAGTCGGAAGGACTTTCGCTTTTTTGCTTCCACCACAGAAGATGCAATTCAGTGGGTCAATGCATTTGCAGATCAGCAGTGCTATGTAAATTGCTTGCCTCACCCTATGGCTTCTAATAATCAGAGTTCAGATACGATTTTCAGTGA...

Protein

Download Protein FASTA

515 aa · TkAUNG000080|TK1151|PROTEIN

MLRLDDVISLSFCVGLRHFTLHAYPFRKGSCPFMKSGRSRKDFRFFASTTEDAIQWVNAFADQQCYVNCLPHPMASNNQSSDTIFSEFPPESYIRSKSPPKMLVILNPRSGRGRSSKVFHGLVEPIFKLAGFELEVVKTTSAGHARKLAASVDFSTCPDGIICVGGDGIINEVLNGLLSRENQKEAISIPIGIIPAGSDNSLVWTVLGVRDPVSAAIAIVKGGLTATDVFAVEWIHTGAIHFGMTVTYFGFISDVLELSE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG000080`
TK1151 ID	TkAUNG000080
OH-1004 ID	LXL04_033396
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	70.000
Protein coverage (%)	TK1151 84.660 / OH-1004 55.469 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG000080

Location ChrUn:22628-29341 (-)

Description Similar to LCBK1: Sphingoid long-chain bases kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23450`	Involved in the production of sphingolipid metabolites.	Phosphorylation of sphingoid long-chain bases in Arabidopsis: functional characterization and expression of the first sphingoid long-chain base Kinase gene in plants.2005 · DOI: 10.1093/pcp/pci023
`At4g21540`	Involved in the production of sphingolipid metabolites.	Involvement of sphingosine kinase in plant cell signalling.2008 · DOI: 10.1111/j.1365-313x.2008.03579.x Phosphatidic acid binds and stimulates Arabidopsis sphingosine kinases.2011 · DOI: 10.1074/jbc.m110.190892 Connections between sphingosine kinase and phospholipase D in the abscisic acid signaling pathway in Arabidopsis.2012 · DOI: 10.1074/jbc.m111.274274
`At4g21534`	Involved in the production of sphingolipid metabolites.	Phosphatidic acid binds and stimulates Arabidopsis sphingosine kinases.2011 · DOI: 10.1074/jbc.m110.190892 Connections between sphingosine kinase and phospholipase D in the abscisic acid signaling pathway in Arabidopsis.2012 · DOI: 10.1074/jbc.m111.274274

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033396 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006665 sphingolipid metabolic process Biological Process

GO:0006672 ceramide metabolic process Biological Process

GO:0006688 glycosphingolipid biosynthetic process Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009845 seed germination Biological Process

GO:0030148 sphingolipid biosynthetic process Biological Process

GO:0046512 sphingosine biosynthetic process Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT4G21534

ath:AT4G21540

ath:AT5G23450

hsa:64781

mmu:223753

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.456

Rank 1 · TkAUNG000080 · TK1151

Nucleus0.225

Rank 2 · TkAUNG000080 · TK1151

Cell membrane0.180

Rank 3 · TkAUNG000080 · TK1151

Golgi apparatus0.151

Rank 4 · TkAUNG000080 · TK1151

Mitochondrion0.147

Rank 5 · TkAUNG000080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00781DAGK_cat101-231 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG000080	`PF00781`	DAGK_cat	101	231	6.8e-30	104.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LRB0`	Arabidopsis thaliana	sp\|Q9LRB0\|LCBK1_ARATH Sphingoid long-chain bases kinase 1	71.800%	Swiss-Prot	High
`Q8L7L1`	Arabidopsis thaliana	sp\|Q8L7L1\|SPHK1_ARATH Sphingosine kinase 1	36.500%	Swiss-Prot	Low
`F2Y4A3`	Arabidopsis thaliana	sp\|F2Y4A3\|SPHK2_ARATH Sphingosine kinase 2	34.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card