TkAUNG000010 | RubberDandelionOmics

Gene overview

TkAUNG000010

Reference: TK1151 Chr: ChrUn Coordinates: 2719-3172 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

339 bp · TkAUNG000010|TK1151|cDNA

ATGGTTTGCAATTGTGGAATTAGGGCTGTCATTCGCACTTCTTGGAGTAATGAAAACCCAGGAAGAAGGTTCAATTCTTGCCTCCACTACAATGGAGGGTGCGGTTTTTTTGCGTGGGAGGACCCCCCAATGTGTGGTAGATCAAGAAGTTTGATACTTGGTTTGTTGAGGAGAATGAATGCAATGGAGAATGAAAACACAAGCTTGAAGAATGAAATTGACAATATGGTTGAGGAGATCAACAAACTGAAGTTGTGTAA...

CDS

Download CDS FASTA

339 bp · TkAUNG000010|TK1151|CDS

ATGGTTTGCAATTGTGGAATTAGGGCTGTCATTCGCACTTCTTGGAGTAATGAAAACCCAGGAAGAAGGTTCAATTCTTGCCTCCACTACAATGGAGGGTGCGGTTTTTTTGCGTGGGAGGACCCCCCAATGTGTGGTAGATCAAGAAGTTTGATACTTGGTTTGTTGAGGAGAATGAATGCAATGGAGAATGAAAACACAAGCTTGAAGAATGAAATTGACAATATGGTTGAGGAGATCAACAAACTGAAGTTGTGTAA...

Protein

Download Protein FASTA

112 aa · TkAUNG000010|TK1151|PROTEIN

MVCNCGIRAVIRTSWSNENPGRRFNSCLHYNGGCGFFAWEDPPMCGRSRSLILGLLRRMNAMENENTSLKNEIDNMVEEINKLKLCNRKLLKLLLSILVICSFWGWMWFGVF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG000010`
TK1151 ID	TkAUNG000010
OH-1004 ID	LXL04_015238
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	47.100
Protein coverage (%)	TK1151 75.893 / OH-1004 65.891 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG000010`
Location	ChrUn:2719-3172 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015238` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.483

Rank 1 · TkAUNG000010 · TK1151

Endoplasmic reticulum0.198

Rank 2 · TkAUNG000010 · TK1151

Cytoplasm0.075

Rank 3 · TkAUNG000010 · TK1151

Mitochondrion0.072

Rank 4 · TkAUNG000010 · TK1151

Cell membrane0.044

Rank 5 · TkAUNG000010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06839Zn_ribbon_GRF2-41 aa

PF28362NcaA_C12-25 aa

PF28362NcaA_C36-86 aa

PF07701HNOBA41-98 aa

PF01166TSC2250-77 aa

PF00170bZIP_154-85 aa

PF25450Rab11-FIP355-92 aa

PF16689APC_N_CC55-83 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG000010	`PF06839`	Zn_ribbon_GRF	2	41	7.2e-10	39.5
TkAUNG000010	`PF28362`	NcaA_C	12	25	0.088	13.5
TkAUNG000010	`PF28362`	NcaA_C	36	86	0.088	13.5
TkAUNG000010	`PF07701`	HNOBA	41	98	0.16	12.1
TkAUNG000010	`PF01166`	TSC22	50	77	0.35	11.8
TkAUNG000010	`PF00170`	bZIP_1	54	85	0.0007	20.4
TkAUNG000010	`PF25450`	Rab11-FIP3	55	92	0.1	13.6
TkAUNG000010	`PF16689`	APC_N_CC	55	83	0.27	12.2
TkAUNG000010	`PF24245`	INO80F	55	91	0.54	11.1
TkAUNG000010	`PF28942`	Fv1_N	55	97	0.68	10.7
TkAUNG000010	`PF05377`	FlaC_arch	58	83	0.086	14.0
TkAUNG000010	`PF15188`	CCDC-167	60	102	0.21	12.6
TkAUNG000010	`PF01166`	TSC22	68	90	0.35	11.8
TkAUNG000010	`PF06839`	Zn_ribbon_GRF	101	106	7.2e-10	39.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card