RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G390160
Reference: TK1151 Chr: Chr07 Coordinates: 97869472-97872717 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3163 bp · TkA07G390160|TK1151|cDNA

AGAGGAGCTAATGCTAATAGGCATCTGATGCAGATTTTGCATTCGATGTTATTCTCTACAAGATTTAGTGGAAGCGTATTAAACTTAAAGACACTTTACATGAAATTCAATTACTACTCTTTTTATCTATATATCTCTTCACTTTCTCACTTCCTCTTAATTATCACCAAACATATCCCCTTTTTTAATCTTCACTTCCTCTCATGGGCTTTCACTATATTTTCATCTTTTATCTTGTATTATTACTTCCATTAATATCA...

CDS

Download CDS FASTA

2814 bp · TkA07G390160|TK1151|CDS

ATGGGCTTTCACTATATTTTCATCTTTTATCTTGTATTATTACTTCCATTAATATCAAGCTCTTATGAAGCTTCAATGGCGGATCAAGCTGAGTTCTTCCCCCTCATGAAGAATTCTCTAACAGGATCTTTTTTAAACGATTGGGATGATAAACCAGTCTGCAATTATAAAGGTGTTATCTGTGATCAAGAAGGGTACGTAGTGAAGATTGATATTTCCGGGCAGGGGCTTTTCGGTCATTTCCCAGAAAACGTATGCTC...

Protein

Download Protein FASTA

937 aa · TkA07G390160|TK1151|PROTEIN

MGFHYIFIFYLVLLLPLISSSYEASMADQAEFFPLMKNSLTGSFLNDWDDKPVCNYKGVICDQEGYVVKIDISGQGLFGHFPENVCSFVPRLRSLSFGYNKIHGDFPQSITNCSFLEQLNITHTNLTGTLPDLSPMKSLKLLDLSSNFFTGAFPMSFINLVNLEIVNFNENAGFDMWRLPENITKLVKLKSMILSTCKVSGTIPKSIGNMTSLVDLELSGNYLVGPVPREIGLLKNLQSLELYYNQLVGGIPEELGNLTE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G390160
TK1151 IDTkA07G390160
OH-1004 IDLXL04_030254
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.200
Protein coverage (%)TK1151 98.613 / OH-1004 94.382
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G390160
LocationChr07:97869472-97872717 (+)
DescriptionSimilar to CEPR1: Receptor protein-tyrosine kinase CEPR1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g49660 Receptor kinase involved in the perception of C-terminally encoded plant signaling peptide (CEP) and subsequent regulation of root and shoot development.
XYLEM INTERMIXED WITH PHLOEM1, a leucine-rich repeat receptor-like kinase required for stem growth and vascular development in Arabidopsis thaliana.2012 · DOI: 10.1007/s00425-011-1489-6
CEP5 and XIP1/CEPR1 regulate lateral root initiation in Arabidopsis.2016 · DOI: 10.1093/jxb/erw231
At1g09970 Plays a role in pattern-triggered immunity (PTI) signaling induced by pathogen-associated molecular patterns (PAMPs).
RLK7, a leucine-rich repeat receptor-like kinase, is required for proper germination speed and tolerance to oxidative stress in Arabidopsis thaliana.2010 · DOI: 10.1007/s00425-010-1260-4
The secreted peptide PIP1 amplifies immunity through receptor-like kinase 7.2014 · DOI: 10.1371/journal.ppat.1004331
At1g28440 Receptor-like protein kinase HSL1. No verified direct reference in this release
At3g19700 Modulates the seed size by negatively regulating the cellularization of syncytial endosperm.
MINISEED3 (MINI3), a WRKY family gene, and HAIKU2 (IKU2), a leucine-rich repeat (LRR) KINASE gene, are regulators of seed size in Arabidopsis.2005 · DOI: 10.1073/pnas.0508418102
At4g28490 Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates that controls floral organ abscission. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_030254 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0006970 response to osmotic stress Biological Process
GO:0006979 response to oxidative stress Biological Process
GO:0009845 seed germination Biological Process
GO:0009960 endosperm development Biological Process
GO:0010051 xylem and phloem pattern formation Biological Process
GO:0010311 lateral root formation Biological Process
GO:0010555 response to mannitol Biological Process
GO:0031540 regulation of anthocyanin biosynthetic process Biological Process
GO:0045087 innate immune response Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0048437 floral organ development Biological Process
KEGG gene cross-reference
ath:AT1G09970
ath:AT1G28440
ath:AT1G72180
ath:AT3G19700
ath:AT5G49660
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.876
Rank 1 · TkA07G390160 · TK1151
Endoplasmic reticulum0.081
Rank 2 · TkA07G390160 · TK1151
Cytoplasm0.061
Rank 3 · TkA07G390160 · TK1151
Nucleus0.034
Rank 4 · TkA07G390160 · TK1151
Lysosome / Vacuole0.028
Rank 5 · TkA07G390160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_235-62 aa
PF00560LRR_169-87 aa
PF13855LRR_883-126 aa
PF12799LRR_490-134 aa
PF24048LRR_NXF1-590-145 aa
PF00560LRR_191-113 aa
PF23598LRR_1491-164 aa
PF23598LRR_1492-244 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G390160PF08263LRRNT_235620.0002621.9
TkA07G390160PF00560LRR_169875.1e-32103.7
TkA07G390160PF13855LRR_8831262.2e-2898.5
TkA07G390160PF12799LRR_4901343.6e-2381.8
TkA07G390160PF24048LRR_NXF1-5901450.212.0
TkA07G390160PF00560LRR_1911135.1e-32103.7
TkA07G390160PF23598LRR_14911641.6e-2177.2
TkA07G390160PF23598LRR_14922441.6e-2177.2
TkA07G390160PF24758LRR_At5g563701031459.7e-0522.8
TkA07G390160PF23286LRR_131051240.1712.2
TkA07G390160PF25019LRR_R13L1-DRL211061450.007416.9
TkA07G390160PF25013LRR_Zer-11101290.0001322.8
TkA07G390160PF00560LRR_11161325.1e-32103.7
TkA07G390160PF29252LRR_NLRC41241610.03414.1
TkA07G390160PF23598LRR_141303321.6e-2177.2
TkA07G390160PF25013LRR_Zer-11331970.0001322.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FGL5Arabidopsis thalianasp|Q9FGL5|CEPR1_ARATH Receptor protein-tyrosine kinase CEPR169.100%Swiss-ProtHigh
F4I2N7Arabidopsis thalianasp|F4I2N7|RLK7_ARATH Receptor-like protein kinase 746.500%Swiss-ProtLow
Q9SGP2Arabidopsis thalianasp|Q9SGP2|HSL1_ARATH Receptor-like protein kinase HSL141.300%Swiss-ProtLow
Q9LJM4Arabidopsis thalianasp|Q9LJM4|IKU2_ARATH Receptor-like protein kinase HAIKU239.800%Swiss-ProtLow
P47735Arabidopsis thalianasp|P47735|RLK5_ARATH Receptor-like protein kinase 542.100%Swiss-ProtLow

JBrowse

View in Genome Browser