TkA07G252100 | RubberDandelionOmics

Gene overview

TkA07G252100

Reference: TK1151 Chr: Chr07 Coordinates: 62890035-62895719 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4576 bp · TkA07G252100|TK1151|cDNA

CCCGGATGGACCAGTATATACATTGTTCATCATTGACTCCTTCCAATATCATGGTTGTGAAGCGTTGTGAGCGGTGTTCAAAGTGAAAATTCTATCCCAAATCCAGTTTTTTGTAGCTATCCTTTTTACGTTTAATCTGTCGTTCTAATTGGGATCATCTTCCACGTCTCCTTCACCAGCGACCATTTCACGGTAACCTTTTGCAAGTTGACTGTTCGAAGCACCCAACTACACGCAAATTGGTTCAATCTCTTATGTTT...

CDS

Download CDS FASTA

3735 bp · TkA07G252100|TK1151|CDS

ATGGATACGAGTAACTGGAGGGGCCCTCAGGGTGGAAATGGTGCTATTGGTGACTCCTCTATGGAATCTGGTGATTGGAGGGCTCAACTACAAGCAGATTCGCGGCAAAGAATCGTGAACAAAATAATGGATACCTTGAAGAGGCATCTTCCCTTCTCCGGACATGAAGGGCTACAGGAACTTAAGAAAATAGCTGTTAGGTTTGAAGAGAAGATTTACACTGCTGCAACAAGTCAGTCTGATTATTTGCGGAAGATATC...

Protein

Download Protein FASTA

1244 aa · TkA07G252100|TK1151|PROTEIN

MDTSNWRGPQGGNGAIGDSSMESGDWRAQLQADSRQRIVNKIMDTLKRHLPFSGHEGLQELKKIAVRFEEKIYTAATSQSDYLRKISLKMLTMETRSQNSMPEAMQANSGANSVNPSDPGSQVMQQVNSQGQPLPIPVPSNQNQQFLSQTMHNNMGSSGIQGSSSLSSALPPGTGLPQSSNIASQNPIQNMSGSQQGNTMGPTNFANQRQIPGRQQPQQPQQQQQQPQQQQQQQQNQNSHYAYQQQLQQMAKQKLQGNNI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G252100`
TK1151 ID	TkA07G252100
OH-1004 ID	LXL04_028938
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G252100

Location Chr07:62890035-62895719 (-)

Description Similar to MED15A: Mediator of RNA polymerase II transcription subunit 15a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15780`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release
`At2g10440`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release
`At1g15770`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028938 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0045723 positive regulation of fatty acid biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016592 mediator complex Cellular Component

GO:0003713 transcription coactivator activity Molecular Function

GO:0031490 chromatin DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G15770

ath:AT1G15780

ath:AT2G10440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.966

Rank 1 · TkA07G252100 · TK1151

Cytoplasm0.142

Rank 2 · TkA07G252100 · TK1151

Cell membrane0.015

Rank 3 · TkA07G252100 · TK1151

Mitochondrion0.013

Rank 4 · TkA07G252100 · TK1151

Endoplasmic reticulum0.007

Rank 5 · TkA07G252100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16987KIX_224-101 aa

PF02172KIX25-94 aa

PF21539Med15_C227-269 aa

PF16987KIX_2259-274 aa

PF21539Med15_C451-484 aa

PF16987KIX_2552-576 aa

PF21539Med15_C648-674 aa

PF21539Med15_C759-792 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G252100	`PF16987`	KIX_2	24	101	4.9e-35	120.0
TkA07G252100	`PF02172`	KIX	25	94	0.07	14.1
TkA07G252100	`PF21539`	Med15_C	227	269	2.3e-06	28.7
TkA07G252100	`PF16987`	KIX_2	259	274	4.9e-35	120.0
TkA07G252100	`PF21539`	Med15_C	451	484	2.3e-06	28.7
TkA07G252100	`PF16987`	KIX_2	552	576	4.9e-35	120.0
TkA07G252100	`PF21539`	Med15_C	648	674	2.3e-06	28.7
TkA07G252100	`PF21539`	Med15_C	759	792	2.3e-06	28.7
TkA07G252100	`PF21539`	Med15_C	1143	1215	2.3e-06	28.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I171`	Arabidopsis thaliana	sp\|F4I171\|MD15A_ARATH Mediator of RNA polymerase II transcription subunit 15a	43.600%	Swiss-Prot	Medium
`Q9SHV7`	Arabidopsis thaliana	sp\|Q9SHV7\|MD15C_ARATH Probable mediator of RNA polymerase II transcription subunit 15c	35.600%	Swiss-Prot	Low
`F4I169`	Arabidopsis thaliana	sp\|F4I169\|MD15B_ARATH Probable mediator of RNA polymerase II transcription subunit 15b	52.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card