TkA07G240410 | RubberDandelionOmics

Gene overview

TkA07G240410

Reference: TK1151 Chr: Chr07 Coordinates: 60058245-60059944 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

776 bp · TkA07G240410|TK1151|cDNA

AAAAGATAGTAGAGGGCATCTTTTGCCATTTACTCAAACACACCTATTAGTCGTCACGCCATCCCTGGAGCCAGACTGAGCACCATTCCCCTCGCCCTAAATCAATTTCCGGTGGAAGCTCAAGAAAGAAGAATCTGGAAGGTAACGACGTGGATTTTATTGTTGGCATTGGGGTTAAAATTCAGATCAATCTGGGATGGCGAGTTCTTTAGACGCTGCAGGAGAACCTATCCCGACATCGGCGGTGCTAATGTCGGCGT...

CDS

Download CDS FASTA

321 bp · TkA07G240410|TK1151|CDS

ATGGCGAGTTCTTTAGACGCTGCAGGAGAACCTATCCCGACATCGGCGGTGCTAATGTCGGCGTCGAAGCATATAGCGACCAGATGTAGAGGTGAAAATGTTGCCTTCCTCAAGTGCAAGAAGGACGATCCCAATCCCGAGAAATGCCTCGAGAAAGGCAGACAAGTGACCCGCTGTGTTTTATCTTTGCTGAAAGATTTACATCAGAAGTGCACAAAAGAGATGGATGCTTATGCTGGATGCATGTACTACAACACTGA...

Protein

Download Protein FASTA

106 aa · TkA07G240410|TK1151|PROTEIN

MASSLDAAGEPIPTSAVLMSASKHIATRCRGENVAFLKCKKDDPNPEKCLEKGRQVTRCVLSLLKDLHQKCTKEMDAYAGCMYYNTDEFELCRKEQKEFEKACPLN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G240410`
TK1151 ID	TkA07G240410
OH-1004 ID	LXL04_028866
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G240410

Location Chr07:60058245-60059944 (-)

Description Similar to At5g18800: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g18800`	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis.	No verified direct reference in this release
`At3g06310`	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028866 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006120 mitochondrial electron transport, NADH to ubiquinone Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005758 mitochondrial intermembrane space Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0045271 respiratory chain complex I Cellular Component

GO:0044877 protein-containing complex binding Molecular Function

KEGG gene cross-reference

ath:AT3G06310

ath:AT5G18800

ncr:NCU02472

pon:100172726

ppyg:129044070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.972

Rank 1 · TkA07G240410 · TK1151

Nucleus0.072

Rank 2 · TkA07G240410 · TK1151

Cytoplasm0.061

Rank 3 · TkA07G240410 · TK1151

Cell membrane0.028

Rank 4 · TkA07G240410 · TK1151

Extracellular0.014

Rank 5 · TkA07G240410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10203Pet191_N20-42 aa

PF16860CX9C25-60 aa

PF01682DB25-60 aa

PF02297COX6B26-52 aa

PF08583Cmc126-45 aa

PF06747CHCH28-41 aa

PF29408BAS336-55 aa

PF15083Colipase-like36-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G240410	`PF10203`	Pet191_N	20	42	0.052	14.5
TkA07G240410	`PF16860`	CX9C	25	60	2.6e-08	34.4
TkA07G240410	`PF01682`	DB	25	60	0.96	10.6
TkA07G240410	`PF02297`	COX6B	26	52	0.00017	22.3
TkA07G240410	`PF08583`	Cmc1	26	45	0.83	10.5
TkA07G240410	`PF06747`	CHCH	28	41	5.3e-10	39.9
TkA07G240410	`PF29408`	BAS3	36	55	0.41	11.7
TkA07G240410	`PF15083`	Colipase-like	36	103	0.51	11.2
TkA07G240410	`PF01682`	DB	39	103	0.96	10.6
TkA07G240410	`PF06747`	CHCH	48	51	5.3e-10	39.9
TkA07G240410	`PF10203`	Pet191_N	48	81	0.052	14.5
TkA07G240410	`PF02428`	Prot_inhib_II	55	92	0.0047	18.0
TkA07G240410	`PF16860`	CX9C	64	100	2.6e-08	34.4
TkA07G240410	`PF08583`	Cmc1	65	100	0.83	10.5
TkA07G240410	`PF29408`	BAS3	67	92	0.41	11.7
TkA07G240410	`PF02297`	COX6B	68	104	0.00017	22.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LGE7`	Arabidopsis thaliana	sp\|Q8LGE7\|NDA8B_ARATH NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-B	75.200%	Swiss-Prot	High
`Q9SQT4`	Arabidopsis thaliana	sp\|Q9SQT4\|NDA8A_ARATH NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-A	76.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card