TkA07G168880 | RubberDandelionOmics

Gene overview

TkA07G168880

Reference: TK1151 Chr: Chr07 Coordinates: 43342686-43343048 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

363 bp · TkA07G168880|TK1151|cDNA

ATGAGGAACACGCCGGCAGATATCATAGAGTATCCGGATTCATACCAGTTCATCGTGGACATGCCGGGGCTGAAGCCGGAGCAGATCAAAGTCCATGTGGAGGACAGCAACGTGCTGGTGGTGAGCGGAGAGAGGCGGAGGGAGAAGGAAGAAGGGGTGAAGTATGTGAGGATGGAAAGGAGGGTTGGGAAGCTGTTGAAAAAGTTCATTTTGCCGGAAAATGCAAACGTGGATGCGGTGTCGGCTGTGAATCAGGACGG...

CDS

Download CDS FASTA

363 bp · TkA07G168880|TK1151|CDS

ATGAGGAACACGCCGGCAGATATCATAGAGTATCCGGATTCATACCAGTTCATCGTGGACATGCCGGGGCTGAAGCCGGAGCAGATCAAAGTCCATGTGGAGGACAGCAACGTGCTGGTGGTGAGCGGAGAGAGGCGGAGGGAGAAGGAAGAAGGGGTGAAGTATGTGAGGATGGAAAGGAGGGTTGGGAAGCTGTTGAAAAAGTTCATTTTGCCGGAAAATGCAAACGTGGATGCGGTGTCGGCTGTGAATCAGGACGG...

Protein

Download Protein FASTA

120 aa · TkA07G168880|TK1151|PROTEIN

MRNTPADIIEYPDSYQFIVDMPGLKPEQIKVHVEDSNVLVVSGERRREKEEGVKYVRMERRVGKLLKKFILPENANVDAVSAVNQDGVLKVKVEKLPPPEPKKPRTVEVKVGSPTDECRM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G168880`
TK1151 ID	TkA07G168880
OH-1004 ID	LXL04_028544
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 72.289 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G168880`
Location	Chr07:43342686-43343048 (-)
Description	Similar to SHSP-2: 18.8 kDa class II heat shock protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_028544` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006457 protein folding Biological Process GO:0006950 response to stress Biological Process GO:0009408 response to heat Biological Process GO:0009651 response to salt stress Biological Process GO:0042542 response to hydrogen peroxide Biological Process GO:0051259 protein complex oligomerization Biological Process GO:0071456 cellular response to hypoxia Biological Process GO:0005737 cytoplasm Cellular Component GO:0051082 unfolded protein binding Molecular Function
KEGG gene cross-reference	ath:AT5G12020 gmx:100813195 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.777

Rank 1 · TkA07G168880 · TK1151

Nucleus0.351

Rank 2 · TkA07G168880 · TK1151

Cell membrane0.073

Rank 3 · TkA07G168880 · TK1151

Mitochondrion0.069

Rank 4 · TkA07G168880 · TK1151

Endoplasmic reticulum0.053

Rank 5 · TkA07G168880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00011HSP207-110 aa

PF23444DUF71279-48 aa

PF17886ArsA_HSP2013-47 aa

PF27746Small_heat_shock_put17-93 aa

PF19670DUF617325-48 aa

PF19670DUF617362-103 aa

PF17886ArsA_HSP2064-92 aa

PF23444DUF712780-93 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G168880	`PF00011`	HSP20	7	110	1.5e-27	96.4
TkA07G168880	`PF23444`	DUF7127	9	48	0.028	15.5
TkA07G168880	`PF17886`	ArsA_HSP20	13	47	0.00044	20.5
TkA07G168880	`PF27746`	Small_heat_shock_put	17	93	0.012	15.6
TkA07G168880	`PF19670`	DUF6173	25	48	0.05	14.7
TkA07G168880	`PF19670`	DUF6173	62	103	0.05	14.7
TkA07G168880	`PF17886`	ArsA_HSP20	64	92	0.00044	20.5
TkA07G168880	`PF23444`	DUF7127	80	93	0.028	15.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card