TkA07G051970 | RubberDandelionOmics

Gene overview

TkA07G051970

Reference: TK1151 Chr: Chr07 Coordinates: 13791664-13801147 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4536 bp · TkA07G051970|TK1151|cDNA

GTTTCATGAGAGATATAGGTTGAGCAACCCACTTGCTCACGGATAAGCCAAAGTGTTTGCGCTTCAACCTTCGGCAAATCAACAGAGACTATCACACGTCATACATTTCTTCTCTCTGAGGTCTCGCTCCAAGCCATCAACAATCGACACTCTCTACACCGATCTCGGTCTCACATGCTAACTTCATATACCTAGTCACACTTGATTTTTGAGCCGCTAGGTTGTTTAGCTCCGGGGAGTCCTCGGTCTACATTCTACAA...

CDS

Download CDS FASTA

2211 bp · TkA07G051970|TK1151|CDS

ATGGAGGAAACACAAACAGACACTATCCAAACGGGTAAAAACCAATCTTCAGATGGATCTTTTAAATTCAAAAGAATGCATAGCGATCGCCAGCTGGCAGCAGATTCAGGAGCACAAAGAGTGGCACAAGTCCTCTGGTCCACCGGCAATCTTTATGAACCAATCCCTAGCGGGTTCTATTCCATTTTACCTGAAAAAAGACTCAAAGAGAAATACGACATGATCCCTTCTCTCGAAGAGCTTCACGTGTTAGAATCAGA...

Protein

Download Protein FASTA

736 aa · TkA07G051970|TK1151|PROTEIN

MEETQTDTIQTGKNQSSDGSFKFKRMHSDRQLAADSGAQRVAQVLWSTGNLYEPIPSGFYSILPEKRLKEKYDMIPSLEELHVLESEGFKLNVIVVDMQKDKKVSMLQQLALTLAKGLTSNPAAVIKKIGGLVCDFYKLPNVELNHAKSAWEEVYNVHNQGIQMLGQIKHGFCHPRAILFKVLADTVGLDCRVMVGLPKEAESERTDSHRHVSVIVELNSTELLVDIVRYPGHLVPFSTKAVYMSHVYVIGQGDSGENDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G051970`
TK1151 ID	TkA07G051970
OH-1004 ID	LXL04_027347
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G051970

Location Chr07:13791664-13801147 (-)

Description Similar to SIS8: Probable serine/threonine-protein kinase SIS8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73660`	Acts as a negative regulator of salt tolerance.	The genetic locus At1g73660 encodes a putative MAPKKK and negatively regulates salt tolerance in Arabidopsis.2008 · DOI: 10.1007/s11103-008-9306-8 SIS8, a putative mitogen-activated protein kinase kinase kinase, regulates sugar-resistant seedling development in Arabidopsis.2014 · DOI: 10.1111/tpj.12404
`At5g03730`	Acts as a negative regulator in the ethylene response pathway.	CTR1 phosphorylates the central regulator EIN2 to control ethylene hormone signaling from the ER membrane to the nucleus in Arabidopsis.2012 · DOI: 10.1073/pnas.1214848109 Unsaturation of very-long-chain ceramides protects plant from hypoxia-induced damages by modulating ethylene signaling in Arabidopsis.2015 · DOI: 10.1371/journal.pgen.1005143 CTR1, a negative regulator of the ethylene response pathway in Arabidopsis, encodes a member of the raf family of protein kinases.1993 · DOI: 10.1016/0092-8674(93)90119-b
`At1g08720`	MAPKKK serine/threonine-protein kinase involved in the regulation of a MAP kinase cascade (probably including MPK3 and MPK6) that negatively regulates salicylic acid- (SA-) dependent defense responses, abscisic acid (ABA) signaling, and ethylene-induced senescence.	Negative regulation of defense responses in plants by a conserved MAPKK kinase.2001 · DOI: 10.1073/pnas.98.1.373 Overexpression of a kinase-deficient form of the EDR1 gene enhances powdery mildew resistance and ethylene-induced senescence in Arabidopsis.2002 · DOI: 10.1046/j.1365-313x.2002.01482.x Regulation of plant disease resistance, stress responses, cell death, and ethylene signaling in Arabidopsis by the EDR1 protein kinase.2005 · DOI: 10.1104/pp.105.060400 Costs and benefits of priming for defense in Arabidopsis.2006 · DOI: 10.1073/pnas.0510213103 Powdery mildew resistance conferred by loss of the ENHANCED DISEASE RESISTANCE1 protein kinase is suppressed by a missense mutation in KEEP ON GOING, a regulator of abscisic acid signaling.2008 · DOI: 10.1104/pp.108.127605 Mitogen-activated protein kinases 3 and 6 are required for full priming of stress responses in Arabidopsis thaliana.2009 · DOI: 10.1105/tpc.108.062158 The KEEP ON GOING protein of Arabidopsis recruits the ENHANCED DISEASE RESISTANCE1 protein to trans-Golgi network/early endosome vesicles.2011 · DOI: 10.1104/pp.110.171785 Arabidopsis ENHANCED DISEASE RESISTANCE 1 is required for pathogen-induced expression of plant defensins in nonhost resistance, and acts through interference of MYC2-mediated repressor function.2011 · DOI: 10.1111/j.1365-313x.2011.04651.x Negative regulation of defence signalling pathways by the EDR1 protein kinase.2011 · DOI: 10.1111/j.1364-3703.2011.00708.x An Arabidopsis mutant with enhanced resistance to powdery mildew.1998 · DOI: 10.1105/tpc.10.6.947

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027347 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000165 MAPK cascade Biological Process

GO:0001666 response to hypoxia Biological Process

GO:0002229 defense response to oomycetes Biological Process

GO:0007165 signal transduction Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009686 gibberellin biosynthetic process Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009744 response to sucrose Biological Process

KEGG gene cross-reference

ath:AT1G08720

ath:AT1G73660

ath:AT5G03730

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.591

Rank 1 · TkA07G051970 · TK1151

Cell membrane0.329

Rank 2 · TkA07G051970 · TK1151

Nucleus0.266

Rank 3 · TkA07G051970 · TK1151

Golgi apparatus0.069

Rank 4 · TkA07G051970 · TK1151

Lysosome / Vacuole0.046

Rank 5 · TkA07G051970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14381EDR1_CTR1_ARMC3_pept38-235 aa

PF06293Kdo167-182 aa

PF01841Transglut_core168-215 aa

PF00797Acetyltransf_2169-227 aa

PF07714PK_Tyr_Ser-Thr482-729 aa

PF00069Pkinase483-724 aa

PF03109ABC1492-510 aa

PF03109ABC1553-634 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G051970	`PF14381`	EDR1_CTR1_ARMC3_pept	38	235	1.2e-49	169.6
TkA07G051970	`PF06293`	Kdo	167	182	0.44	10.7
TkA07G051970	`PF01841`	Transglut_core	168	215	0.098	13.7
TkA07G051970	`PF00797`	Acetyltransf_2	169	227	0.26	11.8
TkA07G051970	`PF07714`	PK_Tyr_Ser-Thr	482	729	4.4e-61	207.2
TkA07G051970	`PF00069`	Pkinase	483	724	1.1e-50	173.2
TkA07G051970	`PF03109`	ABC1	492	510	0.039	13.8
TkA07G051970	`PF03109`	ABC1	553	634	0.039	13.8
TkA07G051970	`PF06293`	Kdo	576	614	0.44	10.7
TkA07G051970	`PF12330`	Haspin_kinase	577	629	0.0029	17.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9U5`	Arabidopsis thaliana	sp\|Q9C9U5\|SIS8_ARATH Probable serine/threonine-protein kinase SIS8	28.800%	Swiss-Prot	Low
`Q05609`	Arabidopsis thaliana	sp\|Q05609\|CTR1_ARATH Serine/threonine-protein kinase CTR1	47.900%	Swiss-Prot	Low
`Q9FPR3`	Arabidopsis thaliana	sp\|Q9FPR3\|EDR1_ARATH Serine/threonine-protein kinase EDR1	28.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card