Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1970 bp · TkA07G004620|TK1151|cDNA
CGACACGTGAAAAAGATGGATGCTGAAATCGGATTAATTTATAGATGCGAATAGTTGGATGATTGCCGTCCGGATACCGACGCCATAGAAATACTGGAAAAACAGTTCTCTTTCTCTCCAGGATGCGAATAGTTGGATGATTGCCGTCCGGATACCGACGCCATAGAAATACTGGAAAAACAGTTCTCTTTCTCTCCAGGATTATTGCAAAGCTTTGGTCAAAGTTCAACATGTACAGTACGGAAGCAGTGATTGAATTT...
1293 bp · TkA07G004620|TK1151|CDS
ATGTACAGTACGGAAGCAGTGATTGAATTTCTGGGCTGCGTGCCGTTGCTTCAGAGGCTCCCCAGCTTGTCTCTCCGGAAAATCGCACAAGTTGTTACTGTTAAACATTACGAACCACGAGAGTATGTTGTTCGAGAAGGAGAGGCTGGAAATGGAATCTACTTCATATGGGAAGGAGAGGCCGAGGTCTCTGGCTATATCCATGCAGATGAGCATAATAGGCCAGAGTTTCAACTAAAACGTTATGACTACTTTGGCAA...
Protein
Download Protein FASTA430 aa · TkA07G004620|TK1151|PROTEIN
MYSTEAVIEFLGCVPLLQRLPSLSLRKIAQVVTVKHYEPREYVVREGEAGNGIYFIWEGEAEVSGYIHADEHNRPEFQLKRYDYFGNGVAVSAQQADVIALTKLTCLVVPQEHCSLLQSKSIWSADKPLESCSLVESILHLDPIEVNIFKGITLPDAPRFGKVFGGQFIGQALAAASKTVDSLKIVHSLHAYFLLVGDLEIPIIYHVHRVRDGNSFATRRIDAIQKGNVVFTMIASFQKEEVGFDHQLPSMPAVPDPELL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G004620 |
|---|---|
| TK1151 ID | TkA07G004620 |
| OH-1004 ID | LXL04_026732 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 89.100 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G004620 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:1244091-1251945 (-) | |||||||||
| Description | Similar to Acot8: Acyl-coenzyme A thioesterase 8 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006633 fatty acid biosynthetic process Biological Process GO:0006637 acyl-CoA metabolic process Biological Process GO:0009062 fatty acid catabolic process Biological Process GO:0010561 negative regulation of glycoprotein biosynthetic process Biological Process GO:0016559 peroxisome fission Biological Process GO:0033540 fatty acid beta-oxidation using acyl-CoA oxidase Biological Process GO:0036109 alpha-linolenic acid metabolic process Biological Process GO:0043649 dicarboxylic acid catabolic process Biological Process GO:0051289 protein homotetramerization Biological Process GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005777 peroxisome Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G01710 ath:AT4G00520 hsa:10005 mmu:170789 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00027cNMP_binding35-113 aaPF136224HBT_3157-238 aaPF02551Acyl_CoA_thio175-232 aaPF207894HBT_3C308-416 aaPF02551Acyl_CoA_thio313-415 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G004620 | PF00027 | cNMP_binding | 35 | 113 | 2.9e-10 | 40.7 |
| TkA07G004620 | PF13622 | 4HBT_3 | 157 | 238 | 2.8e-18 | 66.6 |
| TkA07G004620 | PF02551 | Acyl_CoA_thio | 175 | 232 | 3.2e-35 | 121.6 |
| TkA07G004620 | PF20789 | 4HBT_3C | 308 | 416 | 9.3e-25 | 88.2 |
| TkA07G004620 | PF02551 | Acyl_CoA_thio | 313 | 415 | 3.2e-35 | 121.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.