Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1257 bp · TkA06G479920|TK1151|cDNA
ATGAAACATTGTTGGCAGTATACAGAAAGCCTAAACCACAATTTAAGGACCCAACAACTTGATTTTCGTAAAGAGTTGTCCATGCTTCCAGACATGGAGTGGTTACTAGCATGCTTCTTTTCTTCCAGTGAAGCTAATGGTAGAAATTCAAGCAAAGTGGTCCTGTATGAAGATGCAGCCAAGAAGCAACTTCAAGAGTTCATAACGGTTCTCAGTGGCTATGCTTTTGATTGGATGGAGGCAAAAAGTTCAGGGCGTAT...
1257 bp · TkA06G479920|TK1151|CDS
ATGAAACATTGTTGGCAGTATACAGAAAGCCTAAACCACAATTTAAGGACCCAACAACTTGATTTTCGTAAAGAGTTGTCCATGCTTCCAGACATGGAGTGGTTACTAGCATGCTTCTTTTCTTCCAGTGAAGCTAATGGTAGAAATTCAAGCAAAGTGGTCCTGTATGAAGATGCAGCCAAGAAGCAACTTCAAGAGTTCATAACGGTTCTCAGTGGCTATGCTTTTGATTGGATGGAGGCAAAAAGTTCAGGGCGTAT...
Protein
Download Protein FASTA418 aa · TkA06G479920|TK1151|PROTEIN
MKHCWQYTESLNHNLRTQQLDFRKELSMLPDMEWLLACFFSSSEANGRNSSKVVLYEDAAKKQLQEFITVLSGYAFDWMEAKSSGRIIPRDGVDKEYDIACTMVADMSLMNYVTVGKDMYLLEVSESLSASVPCDYERRSSKKGCVRYWTPEIKHYIRELSEAESEKRVKTEKHHAEVDWALLDHGTGGSRCACESFKMSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRSSLVALDELGRGTATSDGQAIA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G479920 |
|---|---|
| TK1151 ID | TkA06G479920 |
| OH-1004 ID | LXL04_022524 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 58.800 |
| Protein coverage (%) | TK1151 75.837 / OH-1004 53.311Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G479920 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:118934204-118938325 (-) | |||||||||
| Description | Similar to MSH6: DNA mismatch repair protein MSH6 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000710 meiotic mismatch repair Biological Process GO:0006281 DNA repair Biological Process GO:0006290 pyrimidine dimer repair Biological Process GO:0006298 mismatch repair Biological Process GO:0007095 mitotic G2 DNA damage checkpoint signaling Biological Process GO:0007283 spermatogenesis Biological Process GO:0008340 determination of adult lifespan Biological Process GO:0009411 response to UV Biological Process GO:0032876 negative regulation of DNA endoreduplication Biological Process GO:0045910 negative regulation of DNA recombination Biological Process GO:0000785 chromatin Cellular Component GO:0005634 nucleus Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT4G02070 dme:Dmel_CG7003 hsa:2956 mmu:17688 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF05190MutS_IV110-165 aaPF25016EGF_Pikachurin184-195 aaPF00488MutS_V189-321 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G479920 | PF05190 | MutS_IV | 110 | 165 | 3.7e-10 | 40.7 |
| TkA06G479920 | PF25016 | EGF_Pikachurin | 184 | 195 | 0.088 | 13.4 |
| TkA06G479920 | PF00488 | MutS_V | 189 | 321 | 3e-39 | 135.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.