TkA06G471640 | RubberDandelionOmics

Gene overview

TkA06G471640

Reference: TK1151 Chr: Chr06 Coordinates: 116642974-116645167 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1818 bp · TkA06G471640|TK1151|cDNA

ATGAAGGTGTATGTGGACCAGTACAATGAGCCAATCTTCGACTGGATTGAGGCGGATGATGGAGAAGAGGAAGGTGGTGAAGATCTTGACTGTGAGGAAGATGAAGATTCCGTCTTTTCTGATCCAGAATCTGTTGATCATGAGGAAGATGGTGAATTGGATGCCAACAATCACACAACAACCGATCAATTCTTAAACATCTTGTGCCCATCAGCCCCTCTCAATGAAGATAACGATGATGATGTACCTCAATACCCCAT...

CDS

Download CDS FASTA

1818 bp · TkA06G471640|TK1151|CDS

ATGAAGGTGTATGTGGACCAGTACAATGAGCCAATCTTCGACTGGATTGAGGCGGATGATGGAGAAGAGGAAGGTGGTGAAGATCTTGACTGTGAGGAAGATGAAGATTCCGTCTTTTCTGATCCAGAATCTGTTGATCATGAGGAAGATGGTGAATTGGATGCCAACAATCACACAACAACCGATCAATTCTTAAACATCTTGTGCCCATCAGCCCCTCTCAATGAAGATAACGATGATGATGTACCTCAATACCCCAT...

Protein

Download Protein FASTA

605 aa · TkA06G471640|TK1151|PROTEIN

MKVYVDQYNEPIFDWIEADDGEEEGGEDLDCEEDEDSVFSDPESVDHEEDGELDANNHTTTDQFLNILCPSAPLNEDNDDDVPQYPIHNDKQAWDKMEPILGMRFSNPSELKHMLSNYAVAHGYDLWFEKNDANRLLVKCCKKKTRPCCPFRLWASWMGSERTFQIKSLKAEHNCSRAFKLGAIVTYKCVHQCRNAKKFALQEVEGNLIQHYGKLWSYGAEIMRSNPGSTVRVDVDLVPDSNSTLFSKIYVCFKAVKDGW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G471640`
TK1151 ID	TkA06G471640
OH-1004 ID	LXL04_011904
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	73.300
Protein coverage (%)	TK1151 90.909 / OH-1004 75.154 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G471640`
Location	Chr06:116642974-116645167 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011904` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.958

Rank 1 · TkA06G471640 · TK1151

Cytoplasm0.094

Rank 2 · TkA06G471640 · TK1151

Cell membrane0.024

Rank 3 · TkA06G471640 · TK1151

Endoplasmic reticulum0.017

Rank 4 · TkA06G471640 · TK1151

Mitochondrion0.012

Rank 5 · TkA06G471640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03108DBD_Tnp_Mut101-166 aa

PF00250Forkhead246-292 aa

PF10551MULE277-339 aa

PF00872Transposase_mut278-349 aa

PF00250Forkhead349-392 aa

PF10551MULE402-439 aa

PF00250Forkhead437-452 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G471640	`PF03108`	DBD_Tnp_Mut	101	166	1.5e-08	34.9
TkA06G471640	`PF00250`	Forkhead	246	292	0.09	13.6
TkA06G471640	`PF10551`	MULE	277	339	1.9e-08	35.3
TkA06G471640	`PF00872`	Transposase_mut	278	349	1.1e-06	28.5
TkA06G471640	`PF00250`	Forkhead	349	392	0.09	13.6
TkA06G471640	`PF10551`	MULE	402	439	1.9e-08	35.3
TkA06G471640	`PF00250`	Forkhead	437	452	0.09	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card