TkA06G272980 | RubberDandelionOmics

Gene overview

TkA06G272980

Reference: TK1151 Chr: Chr06 Coordinates: 69258647-69261662 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1014 bp · TkA06G272980|TK1151|cDNA

ATGTCTCCTCAGATTCACAAAACAAGAGGTGATGATGGTGAATGGATCTTACGATTATGTTGGGATAAAAACCAGTATACTACTTATTACATGTATGATCCACATCAAAAACCACCAAAAGTACTCGGTTACCAAATGGACTGGAACGTAGGATTTGCCTATGCACGGAAAGGCCTGGCAAAGGGGTCACTGGTTTTCAACAAGTCTGCTCTTTCTGTCAGTCCCTTCAAAGTTATGTTGCGAGTGGGAGAAGGAAACCA...

CDS

Download CDS FASTA

1014 bp · TkA06G272980|TK1151|CDS

ATGTCTCCTCAGATTCACAAAACAAGAGGTGATGATGGTGAATGGATCTTACGATTATGTTGGGATAAAAACCAGTATACTACTTATTACATGTATGATCCACATCAAAAACCACCAAAAGTACTCGGTTACCAAATGGACTGGAACGTAGGATTTGCCTATGCACGGAAAGGCCTGGCAAAGGGGTCACTGGTTTTCAACAAGTCTGCTCTTTCTGTCAGTCCCTTCAAAGTTATGTTGCGAGTGGGAGAAGGAAACCA...

Protein

Download Protein FASTA

337 aa · TkA06G272980|TK1151|PROTEIN

MSPQIHKTRGDDGEWILRLCWDKNQYTTYYMYDPHQKPPKVLGYQMDWNVGFAYARKGLAKGSLVFNKSALSVSPFKVMLRVGEGNQHEILSYFTPGTYVNKDSAVAARLAAGLCADLALAIYTGRAKNGFARVRPPGHHAGVKQDMGFCLHNNAAIAAFAAQAVGAIGGIFGFGKGSASVPFLWLLLWITDVIWYMWSLRPILKRVLYGVGKLAAFWLFSNFFNWLHKCVKMLTSEPNDQHQILAFNWFDFHLQKHKST...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G272980`
TK1151 ID	TkA06G272980
OH-1004 ID	LXL04_023568
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	83.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G272980

Location Chr06:69258647-69261662 (-)

Description Similar to CIPK24: CBL-interacting protein kinase 24

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18520`	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4).	PHYTOCHROME INTERACTING FACTOR3 associates with the histone deacetylase HDA15 in repression of chlorophyll biosynthesis and photosynthesis in etiolated Arabidopsis seedlings.2013 · DOI: 10.1105/tpc.113.109710 MYB96 recruits the HDA15 protein to suppress negative regulators of ABA signaling in Arabidopsis.2019 · DOI: 10.1038/s41467-019-09417-1 HY5 Interacts with the Histone Deacetylase HDA15 to Repress Hypocotyl Cell Elongation in Photomorphogenesis.2019 · DOI: 10.1104/pp.19.00055 Arabidopsis histone deacetylase HDA15 directly represses plant response to elevated ambient temperature.2019 · DOI: 10.1111/tpj.14492
`At5g35410`	May regulate intracellular Na⁺/K⁺ homeostasis and salt tolerance.	The Arabidopsis SOS2 protein kinase physically interacts with and is activated by the calcium-binding protein SOS3.2000 · DOI: 10.1073/pnas.97.7.3735 Regulation of SOS1, a plasma membrane Na+/H+ exchanger in Arabidopsis thaliana, by SOS2 and SOS3.2002 · DOI: 10.1073/pnas.122224699 The protein kinase SOS2 activates the Arabidopsis H(+)/Ca(2+) antiporter CAX1 to integrate calcium transport and salt tolerance.2004 · DOI: 10.1074/jbc.m309084200
`At4g24400`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0536000`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`Os06g0606000`	May regulate intracellular Na⁺/K⁺ homeostasis and salt tolerance.	Conservation of the salt overly sensitive pathway in rice.2007 · DOI: 10.1104/pp.106.092635

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023568 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009749 response to glucose Biological Process

GO:0010167 response to nitrate Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048364 root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT4G24400

ath:AT5G35410

dosa:Os01g0536000

dosa:Os03g0319400

dosa:Os06g0606000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.268

Rank 1 · TkA06G272980 · TK1151

Cytoplasm0.203

Rank 2 · TkA06G272980 · TK1151

Mitochondrion0.195

Rank 3 · TkA06G272980 · TK1151

Golgi apparatus0.129

Rank 4 · TkA06G272980 · TK1151

Nucleus0.124

Rank 5 · TkA06G272980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00850Hist_deacetyl95-164 aa

PF00069Pkinase271-311 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G272980	`PF00850`	Hist_deacetyl	95	164	1.2e-16	61.6
TkA06G272980	`PF00069`	Pkinase	271	311	8.1e-05	22.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GXJ1`	Arabidopsis thaliana	sp\|Q8GXJ1\|HDA15_ARATH Histone deacetylase 15	74.400%	Swiss-Prot	Low
`Q9LDI3`	Arabidopsis thaliana	sp\|Q9LDI3\|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24	64.200%	Swiss-Prot	Low
`Q9STV4`	Arabidopsis thaliana	sp\|Q9STV4\|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8	57.000%	Swiss-Prot	Low
`Q5JLD8`	Oryza sativa subsp. japonica	sp\|Q5JLD8\|CIPK8_ORYSJ CBL-interacting protein kinase 8	64.200%	Swiss-Prot	Low
`Q69Q47`	Oryza sativa subsp. japonica	sp\|Q69Q47\|CIPKO_ORYSJ CBL-interacting protein kinase 24	64.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card