TkA06G235200 | RubberDandelionOmics

Gene overview

TkA06G235200

Reference: TK1151 Chr: Chr06 Coordinates: 60342048-60345790 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2339 bp · TkA06G235200|TK1151|cDNA

TTGCCATTCATGTTTTCGTTCCCTAAAAAAGTGGGTAAGTTTCGTAACCGTAGTTAACACTCAACACACGAAAGCAAAGTAAAGACATTTGAAAACCATGAATGCATATGGAAATACAATTGTAGGTTTTGGTATTTCTAGGTATTATATTAGTCAAAAATCAAAATCAAACGTATCTGGATCACTGATTGGAGATTTGCGAATCGCCATTTGTTGAAGCTTGAACATGGTCAAAGTTCAACCCACAAATTAATTAACCC...

CDS

Download CDS FASTA

1590 bp · TkA06G235200|TK1151|CDS

ATGAAGTCATCGCTGGGGAAACTCGGGAGGAAATTATCTTTACAGAAGAGCGATGTGAAGGAGACAAGGGATCATCAGCCTTCCGCCCATATAGACGAGATTGCTCAAGCTTCAAAGGATATGCAAGATATGCGAAACTGCTATGATGGTTTATTATCTGCAGCAGCTGCAACTGCAAATAGTATATACGAATTTTCGGAGTCACTAAATGAAATGGGGAGCTGTTTGTTAGGGAAAACCGGTGCTGATGCTGATGGTGA...

Protein

Download Protein FASTA

529 aa · TkA06G235200|TK1151|PROTEIN

MKSSLGKLGRKLSLQKSDVKETRDHQPSAHIDEIAQASKDMQDMRNCYDGLLSAAAATANSIYEFSESLNEMGSCLLGKTGADADGESGKMLSTLADMQLELQKIADTYRSDVVVTITNPSESLLSELRKVEEMKLQCDEKREVYEYMMTQQREKGKLRNGKVDQKLKEAQEEFDEAARLCVFRVKSLKEGQCRSLLTQAARHHAAQVNFFRKGLKVLEAVEPSIRNVAEKHRIDYQISGLYDEGGEPMSGYESTDDGEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G235200`
TK1151 ID	TkA06G235200
OH-1004 ID	LXL04_023729
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.400
Protein coverage (%)	TK1151 99.244 / OH-1004 99.812 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G235200

Location Chr06:60342048-60345790 (-)

Description Similar to At2g33490: Uncharacterized protein At2g33490

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g33490`	Uncharacterized protein At2g33490.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023729 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G33490

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.560

Rank 1 · TkA06G235200 · TK1151

Cell membrane0.289

Rank 2 · TkA06G235200 · TK1151

Nucleus0.198

Rank 3 · TkA06G235200 · TK1151

Golgi apparatus0.114

Rank 4 · TkA06G235200 · TK1151

Lysosome / Vacuole0.061

Rank 5 · TkA06G235200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10455BAR_222-221 aa

PF16746BAR_330-231 aa

PF06456Arfaptin32-111 aa

PF14381EDR1_CTR1_ARMC3_pept101-195 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G235200	`PF10455`	BAR_2	22	221	0.0006	19.9
TkA06G235200	`PF16746`	BAR_3	30	231	1.6e-07	31.9
TkA06G235200	`PF06456`	Arfaptin	32	111	0.45	10.8
TkA06G235200	`PF14381`	EDR1_CTR1_ARMC3_pept	101	195	0.28	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22799`	Arabidopsis thaliana	sp\|O22799\|Y2349_ARATH Uncharacterized protein At2g33490	42.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card