TkA06G225120 | RubberDandelionOmics

Gene overview

TkA06G225120

Reference: TK1151 Chr: Chr06 Coordinates: 58034875-58036917 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1145 bp · TkA06G225120|TK1151|cDNA

ATTCAGGGTAGTTTTGCCACAAACCCAGACTTAACTTAAATAGAATCAAATTTGGTTGGGGCAATTTGCAAATTGTTGAAAGTTGCAAGTTTGAACGGGTTTGAGAACCCCGCTCATGGAGTCTCCTTCATCGGCCATTAGAGCAGCGAAGCCAAACCCTAAGTCGCCATCTCCCGCCGCCGCCACCACCTCCAACCATCTCGTGCCAGTCGTCGGTTCAACGGCCACCCTACAACGTCGACCATCATCCGCAAGAGAGA...

CDS

Download CDS FASTA

525 bp · TkA06G225120|TK1151|CDS

ATGTTTGAAGCCCTGATTCTCCCGATTGAAGCTTCCATTAGGCCTCCTCCAATCGGTCACCAGAACAGAATACGAAGCAAAAATCCCACGGTTTTCCAACTCATTCGCCATCCTCCTATCCCAGAAAAGGGGATGAAAACCAGAAATCAAGCCAAACGACCGCGTCTATCATATGGTGAGAATGGCACGATTAGTGAAGCTGGAGATGATCCAAAAGCAAATGTGGAGAACTCAACACCTATGGAAGCTAAGTCTGAATT...

Protein

Download Protein FASTA

174 aa · TkA06G225120|TK1151|PROTEIN

MFEALILPIEASIRPPPIGHQNRIRSKNPTVFQLIRHPPIPEKGMKTRNQAKRPRLSYGENGTISEAGDDPKANVENSTPMEAKSELEDEMGYIINHQTLACVQNLLTNNIKRRIKKEACWTISNLTAGNMEQIQLSDKVMEYGVTALRILNQVLMLQVSPLIIFYQMRWKSDC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G225120`
TK1151 ID	TkA06G225120
OH-1004 ID	LXL04_029571
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	82.400
Protein coverage (%)	TK1151 100.000 / OH-1004 68.404 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G225120

Location Chr06:58034875-58036917 (+)

Description Similar to Os05g0155601: Importin subunit alpha-1b

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09270`	Binds to conventional NLS motifs and mediates nuclear protein import across the nuclear envelope.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0253300`	Functions in nuclear protein import.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029571 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006606 protein import into nucleus Biological Process

GO:0006607 NLS-bearing protein import into nucleus Biological Process

GO:0006952 defense response Biological Process

GO:0009651 response to salt stress Biological Process

GO:0071555 cell wall organization Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0042564 NLS-dependent protein nuclear import complex Cellular Component

KEGG gene cross-reference

ath:AT3G06720

ath:AT4G02150

sly:543535

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.598

Rank 1 · TkA06G225120 · TK1151

Cytoplasm0.353

Rank 2 · TkA06G225120 · TK1151

Mitochondrion0.086

Rank 3 · TkA06G225120 · TK1151

Cell membrane0.047

Rank 4 · TkA06G225120 · TK1151

Endoplasmic reticulum0.035

Rank 5 · TkA06G225120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14678FANCI_S486-160 aa

PF19162DUF584499-158 aa

PF00514Arm105-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G225120	`PF14678`	FANCI_S4	86	160	0.14	12.1
TkA06G225120	`PF19162`	DUF5844	99	158	0.0061	17.6
TkA06G225120	`PF00514`	Arm	105	128	0.00092	19.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80480`	Arabidopsis thaliana	sp\|O80480\|IMPA4_ARATH Importin subunit alpha-4	73.300%	Swiss-Prot	Low
`Q71VM4`	Oryza sativa subsp. japonica	sp\|Q71VM4\|IMA1A_ORYSJ Importin subunit alpha-1a	69.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card