TkA06G087550 | RubberDandelionOmics

Gene overview

TkA06G087550

Reference: TK1151 Chr: Chr06 Coordinates: 23370853-23380976 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1751 bp · TkA06G087550|TK1151|cDNA

ATAAAATAAGATTTTGACTTCGATACTCAACAAACACCCTTCAAATTCACAAATTCCACTCTCACACAACACCACCACCACCGATCAGAACCCCAAAAAGCACTAGAAACAAATTCTCCCAATCTTTCTGAAACCCCCTTCTATTTCGTGTAATGACGGGTTCTCAAAATGTTACTCCAATCCAATCTCAGAACGGCAAACACCCACAAGATTCAGGCCACTCGCGGTTAAACGAATTGGGATACAAACAAGAACTCAAG...

CDS

Download CDS FASTA

1638 bp · TkA06G087550|TK1151|CDS

ATGCTCGGCTTACCCTACAGCCGGTGGGCTGTATTTTTGGAGCGCAAAGCTTTGCGGCAAAGAATGGGCGCCGTTTGCTTCTTGGCTCACAGGCTGAACGGCAAACACCCACAAGATTCAGGCCACTCGCGGTTAAACGAATTGGGATACAAACAAGAACTCAAGCGTGACCTCTCGGTGTTGTCAAATTTTGCGTTTTCGTTCTCGATTATATCGGTGCTTACAGGTATTACGACACTGTACAATAGTGGGCTAAGATT...

Protein

Download Protein FASTA

545 aa · TkA06G087550|TK1151|PROTEIN

MLGLPYSRWAVFLERKALRQRMGAVCFLAHRLNGKHPQDSGHSRLNELGYKQELKRDLSVLSNFAFSFSIISVLTGITTLYNSGLRFGGPVVLIYGWLIAGVFTMAVGLSMAEICSSYPTSGGLYYWSAKLAGHNWAPFASWLFCRYNIVGQWAVTTSVNFSLAQLIEVIILLSTGGKNGGGYVASKYIVLAIHGGLLLVHAIINSLPISWLSFFGQLAAVWNILGVFFLMICIPVVAKERASAEFVFTHFNTDNDAGIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G087550`
TK1151 ID	TkA06G087550
OH-1004 ID	LXL04_025018
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 84.365 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G087550

Location Chr06:23370853-23380976 (-)

Description Similar to BAT1: Amino-acid permease BAT1 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01170`	May play a role in primary carbon metabolism and plant growth, by mediating the transport of GABA from the cytosol to mitochondria.	BAT1, a bidirectional amino acid transporter in Arabidopsis.2009 · DOI: 10.1007/s00425-009-0892-8 A mitochondrial GABA permease connects the GABA shunt and the TCA cycle, and is essential for normal carbon metabolism.2011 · DOI: 10.1111/j.1365-313x.2011.04612.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0607200`	May be involved in the transport of amino acids.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025018 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0003333 amino acid transmembrane transport Biological Process

GO:0015695 organic cation transport Biological Process

GO:0015812 gamma-aminobutyric acid transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0016020 membrane Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0032153 cell division site Cellular Component

GO:0051286 cell tip Cellular Component

GO:0005313 L-glutamate transmembrane transporter activity Molecular Function

GO:0015171 amino acid transmembrane transporter activity Molecular Function

GO:0015180 L-alanine transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G01170

dosa:Os01g0607200

spo:2539903

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.342

Rank 1 · TkA06G087550 · TK1151

Lysosome / Vacuole0.256

Rank 2 · TkA06G087550 · TK1151

Endoplasmic reticulum0.193

Rank 3 · TkA06G087550 · TK1151

Golgi apparatus0.120

Rank 4 · TkA06G087550 · TK1151

Cytoplasm0.112

Rank 5 · TkA06G087550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13520AA_permease_258-515 aa

PF00324AA_permease75-532 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G087550	`PF13520`	AA_permease_2	58	515	1e-54	186.8
TkA06G087550	`PF00324`	AA_permease	75	532	1.2e-24	87.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZU50`	Arabidopsis thaliana	sp\|Q9ZU50\|BAT1_ARATH Amino-acid permease BAT1	75.800%	Swiss-Prot	High
`B9EXZ6`	Oryza sativa subsp. japonica	sp\|B9EXZ6\|BAT1_ORYSJ Amino-acid permease BAT1 homolog	76.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card