TkA06G040750 | RubberDandelionOmics

Gene overview

TkA06G040750

Reference: TK1151 Chr: Chr06 Coordinates: 11021744-11025980 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1854 bp · TkA06G040750|TK1151|cDNA

AATATTTATTTATTTCCAAACCTCACATGCTTAAACTCTAAAAAAACTCAAAACCCCCCATTTTTTGTGCTCAAATCATCAATACCTGAGCTATTTAATTGCTTGTCTCCTTGGAGTTGTTGTTGTCAGAGCATAGAAATCAAGGTATAGAATTAGAATAGAAACTTTTAGAGAGAGAAACAGTATCTCATCACAAGTGGGATTTTGTTTTCGGTTTTTAAAAAAACATCATTTGGTGTGAATTTGGAAGCTCTTTAGAA...

CDS

Download CDS FASTA

1266 bp · TkA06G040750|TK1151|CDS

ATGGATTTCAGTTATTATAACTTTCACATATTTCCAATCATTTCCTCCTTTGTTTTCTTCCTCTTGTTGTGTTCTACTGTTTTTCCGGCTGTGTCAGCGGCGCCATTTGAAGATTTCCGGCGAATGAATCAAACTTTCCGGCCAGGGGAAGAGTCGAAGAAACTGAGATTGATTAGAACCCATCTCATGAAAATCAACAAACCTTCAGTCAAAACAATTCAGAGTCCAGATGGGGATATAATGGATTGCGTTTTGGTTCA...

Protein

Download Protein FASTA

421 aa · TkA06G040750|TK1151|PROTEIN

MDFSYYNFHIFPIISSFVFFLLLCSTVFPAVSAAPFEDFRRMNQTFRPGEESKKLRLIRTHLMKINKPSVKTIQSPDGDIMDCVLVHHQPAFDHPVLKGTKPLDPPERPNGYHYPGMESENYQLWSLSGESCPEGTIPIRRTTEGDILRANSIQRFGRKIPKPVRRDSSNGGHEHAVGYVSGEEYYGAKASINVWDPKVTDRFEFSLSQMWVISGSFGDDLNTIEAGWQVSPELYGDNYPRFFTYWTTDAYQATGCYNLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G040750`
TK1151 ID	TkA06G040750
OH-1004 ID	LXL04_025830
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G040750`
Location	Chr06:11021744-11025980 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025830` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0005576 extracellular region Cellular Component GO:0004175 endopeptidase activity Molecular Function GO:0004252 serine-type endopeptidase activity Molecular Function GO:0070012 oligopeptidase activity Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.489

Rank 1 · TkA06G040750 · TK1151

Extracellular0.206

Rank 2 · TkA06G040750 · TK1151

Golgi apparatus0.116

Rank 3 · TkA06G040750 · TK1151

Cytoplasm0.111

Rank 4 · TkA06G040750 · TK1151

Endoplasmic reticulum0.098

Rank 5 · TkA06G040750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14365Neprosin_AP72-179 aa

PF08334T2SSG90-131 aa

PF03080Neprosin204-414 aa

PF08334T2SSG404-416 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G040750	`PF14365`	Neprosin_AP	72	179	9.3e-37	126.9
TkA06G040750	`PF08334`	T2SSG	90	131	0.73	10.6
TkA06G040750	`PF03080`	Neprosin	204	414	2.2e-87	292.6
TkA06G040750	`PF08334`	T2SSG	404	416	0.73	10.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card