TkA06G005380 | RubberDandelionOmics

Gene overview

TkA06G005380

Reference: TK1151 Chr: Chr06 Coordinates: 1374073-1376188 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2023 bp · TkA06G005380|TK1151|cDNA

CTAGCATCATGTGGTTAACAAGGAGAAGATCCTTGGGTCGGCATTAAATCCCCTTTTTAACTTACATTTCACTAAATCCTGACCTGACCCACTCACCTACATCATTATTGATTGGTTCTAATTTTCCTCCTCTGCCACAGCTTGTCGCAGTGATGTCGAAATTAATCACCACCGCGGTATCTGACGCCTGGTCACGGTTGTGGGGAAGCGCCAACGGCAACGAAGAGGTCACTGGCACTGCTCTCATCATCGCCGCTATA...

CDS

Download CDS FASTA

1572 bp · TkA06G005380|TK1151|CDS

ATGTCGAAATTAATCACCACCGCGGTATCTGACGCCTGGTCACGGTTGTGGGGAAGCGCCAACGGCAACGAAGAGGTCACTGGCACTGCTCTCATCATCGCCGCTATACTTTCTATATTCTGGCTTGTATGGATGTTGTTTTCAAAGGAAACCAACCCGCCGCTCCCGCCCGGCCCACGGTCGCTGCCACTCGTCGGAAACCTCCTGTCTCTTGATCCAGAGCTCCACTCCTACTTCGCCACTCTCGCAAAAACCTACGG...

Protein

Download Protein FASTA

523 aa · TkA06G005380|TK1151|PROTEIN

MSKLITTAVSDAWSRLWGSANGNEEVTGTALIIAAILSIFWLVWMLFSKETNPPLPPGPRSLPLVGNLLSLDPELHSYFATLAKTYGPISRLWLGKKLGILITSPALAREVLKLNDITFANRDVPVAGVEAAYGGNDIVWSPYGDQWRMLRKIVVREMLSNQTLDSVYSLRRREIRNTVNYLYNRAGSPVNIGEQMFLTVLNVITGMLWGGTVKAEDRESLGAEFRQVINEMTGYLGMPNLSDFYPGLARFDLQGVQKNM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G005380`
TK1151 ID	TkA06G005380
OH-1004 ID	LXL04_023255
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	83.300
Protein coverage (%)	TK1151 99.235 / OH-1004 94.900 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G005380

Location Chr06:1374073-1376188 (+)

Description Similar to CYP75B1: Flavonoid 3'-monooxygenase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g07990`	Catalyzes the 3'-hydroxylation of the flavonoid B-ring to the 3',4'-hydroxylated state.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023255 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009411 response to UV Biological Process

GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process

GO:0009733 response to auxin Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0080027 response to herbivore Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005506 iron ion binding Molecular Function

GO:0010333 terpene synthase activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT5G07990

dosa:Os10g0320100

osa:4348304

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.909

Rank 1 · TkA06G005380 · TK1151

Cell membrane0.040

Rank 2 · TkA06G005380 · TK1151

Cytoplasm0.038

Rank 3 · TkA06G005380 · TK1151

Plastid0.034

Rank 4 · TkA06G005380 · TK1151

Golgi apparatus0.029

Rank 5 · TkA06G005380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p45056-505 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G005380	`PF00067`	p450	56	505	2.6e-109	366.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SD85`	Arabidopsis thaliana	sp\|Q9SD85\|F3PH_ARATH Flavonoid 3'-monooxygenase	37.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card