TkA05G432550 | RubberDandelionOmics

Gene overview

TkA05G432550

Reference: TK1151 Chr: Chr05 Coordinates: 107907609-107909858 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1077 bp · TkA05G432550|TK1151|cDNA

ATGGCGACAGTGGAAGAAGACGACGAAGCGCAAGCACCACGAACCGGAGCTGATTACTACCGCATCCGATATTCGCCCCGTGTCTGGTACAAATCAGCTCCCATAACCGTTCATCCTGAGCCGTCGACTTCCGGCGACATCCTCGACTTCCGCCAGACGGAACTGATATCGGAGTCCGATTTCGAGCAAATTGTTTCTCCCGATGGAACATCATCTATATGCGGCTTCGGCTCACTGCTCCCTGATTTCTTCACTGCTCG...

CDS

Download CDS FASTA

1077 bp · TkA05G432550|TK1151|CDS

ATGGCGACAGTGGAAGAAGACGACGAAGCGCAAGCACCACGAACCGGAGCTGATTACTACCGCATCCGATATTCGCCCCGTGTCTGGTACAAATCAGCTCCCATAACCGTTCATCCTGAGCCGTCGACTTCCGGCGACATCCTCGACTTCCGCCAGACGGAACTGATATCGGAGTCCGATTTCGAGCAAATTGTTTCTCCCGATGGAACATCATCTATATGCGGCTTCGGCTCACTGCTCCCTGATTTCTTCACTGCTCG...

Protein

Download Protein FASTA

358 aa · TkA05G432550|TK1151|PROTEIN

MATVEEDDEAQAPRTGADYYRIRYSPRVWYKSAPITVHPEPSTSGDILDFRQTELISESDFEQIVSPDGTSSICGFGSLLPDFFTARHSLPGPVTCYLDLPKIAHTLIQFHTTLPVSDSFPVIINCRDPRSHPLLTAGCFVNPPHIPRNSKVAIVTASLTPESLASLPPFTSITFNSIHSNRESNSKPEVAKTGLGSSAAMTTAVVAALLSYLGVVNLSSDSGAHQENLDVVHIIAQMAHCMAQGKVGSGFDVSSAVYGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G432550`
TK1151 ID	TkA05G432550
OH-1004 ID	LXL04_021938
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G432550

Location Chr05:107907609-107909858 (+)

Description Similar to PMK: Phosphomevalonate kinase, peroxisomal

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31910`	Phosphomevalonate kinase, peroxisomal.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021938 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006696 ergosterol biosynthetic process Biological Process

GO:0010142 farnesyl diphosphate biosynthetic process, mevalonate pathway Biological Process

GO:0016126 sterol biosynthetic process Biological Process

GO:0019287 isopentenyl diphosphate biosynthetic process, mevalonate pathway Biological Process

GO:0031388 organic acid phosphorylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0004631 phosphomevalonate kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G31910

cal:CAALFM_C401870CA

fgr:FGSG_09764

sce:YMR220W

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.688

Rank 1 · TkA05G432550 · TK1151

Nucleus0.489

Rank 2 · TkA05G432550 · TK1151

Peroxisome0.079

Rank 3 · TkA05G432550 · TK1151

Mitochondrion0.063

Rank 4 · TkA05G432550 · TK1151

Cell membrane0.035

Rank 5 · TkA05G432550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00288GHMP_kinases_N191-259 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G432550	`PF00288`	GHMP_kinases_N	191	259	1.7e-07	32.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C6T1`	Arabidopsis thaliana	sp\|Q9C6T1\|PMK_ARATH Phosphomevalonate kinase, peroxisomal	47.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card