TkA05G407520 | RubberDandelionOmics

Gene overview

TkA05G407520

Reference: TK1151 Chr: Chr05 Coordinates: 101329655-101331550 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1416 bp · TkA05G407520|TK1151|cDNA

TTTCAAGATTTATCATCATTTTCCCACCAATCTAGTTTCAATTTCACAACAAAAGCAATTTAAGAAGCAAACTTTACAAAGGTGTAAACTGTTTTTTTTAGAAAATATAGTGGTTGAAGATAAAGATGCCCCTCCCAAAAAAAATAAGTGAGTTGATCTAGCCAAACCGCACCTCCTCCATTGTACACATCTTTCTTGCTTTATGACCACCTTCAATCGCTCCAAAAGTGGGTGGGTGTATGTACTCTCCTTTTTCTCAT...

CDS

Download CDS FASTA

912 bp · TkA05G407520|TK1151|CDS

ATGGATACTGCTCAGTGGTCAGAGGGATTTGGAGTGGTGAAATCCATGGAAGAAAAGAAAACCACTCGACCACAACAACAACAAAAGCCACATGCCGTGAATTGTCCAAGATGCAATTCATCACACACAAAGTTTTGTTACTACAACAATTACAGCCTCTCTCAACCCCGATATTTTTGCAAAACTTGTCGAAGGTACTGGACTGAAGGTGGATCTTTAAGAAATGTTCCGGTAGGTGGCGGTTCACGGCGGAACAAACG...

Protein

Download Protein FASTA

303 aa · TkA05G407520|TK1151|PROTEIN

MDTAQWSEGFGVVKSMEEKKTTRPQQQQKPHAVNCPRCNSSHTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRRNKRSTSSSSSVSSVPATVSVSIPASISKSHLHHQMIMGPQAQNMITQNPSKSNNTLNMIQLGQGQSQGQGQDLNLNYTNISLQFGNLPFNPNTTTASNPTQFSAMEFLKSGFSHDPREVMMNMNSLPNAMIMNNNSPAGFNFSLDGFENGGEGNRQGTMSTVTTTAGTSANARMLF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G407520`
TK1151 ID	TkA05G407520
OH-1004 ID	LXL04_021575
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G407520

Location Chr05:101329655-101331550 (-)

Description Similar to DOF4.6: Dof zinc finger protein DOF4.6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g61850`	Transcription factor specifically involved in the maternal control of seed germination.	No verified direct reference in this release
`At4g24060`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	No verified direct reference in this release
`At4g00940`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	No verified direct reference in this release
`At1g64620`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0567800`	Transcription factor that may transactivate seed storage protein genes in developing seeds.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021575 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009845 seed germination Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0090057 root radial pattern formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT3G55370

ath:AT3G61850

ath:AT4G24060

ath:AT5G60200

dosa:Os04g0567800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.974

Rank 1 · TkA05G407520 · TK1151

Cytoplasm0.087

Rank 2 · TkA05G407520 · TK1151

Cell membrane0.022

Rank 3 · TkA05G407520 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA05G407520 · TK1151

Plastid0.011

Rank 5 · TkA05G407520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23451Zn_ribbon_PaaD23-64 aa

PF12773DZR26-63 aa

PF12760Zn_ribbon_IS159530-65 aa

PF02701Zn_ribbon_Dof32-87 aa

PF27208TP_021435-65 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G407520	`PF23451`	Zn_ribbon_PaaD	23	64	0.0022	18.3
TkA05G407520	`PF12773`	DZR	26	63	1.8	9.5
TkA05G407520	`PF12760`	Zn_ribbon_IS1595	30	65	6.7	7.5
TkA05G407520	`PF02701`	Zn_ribbon_Dof	32	87	6.7e-33	113.3
TkA05G407520	`PF27208`	TP_0214	35	65	0.35	11.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q43385`	Arabidopsis thaliana	sp\|Q43385\|DOF37_ARATH Dof zinc finger protein DOF3.7	33.300%	Swiss-Prot	Medium
`Q8LAP8`	Arabidopsis thaliana	sp\|Q8LAP8\|DOF46_ARATH Dof zinc finger protein DOF4.6	60.000%	Swiss-Prot	Low
`Q9M161`	Arabidopsis thaliana	sp\|Q9M161\|DOF41_ARATH Dof zinc finger protein DOF4.1	77.600%	Swiss-Prot	Low
`Q84JQ8`	Arabidopsis thaliana	sp\|Q84JQ8\|DOF18_ARATH Dof zinc finger protein DOF1.8	59.200%	Swiss-Prot	Low
`Q9SXG8`	Oryza sativa subsp. japonica	sp\|Q9SXG8\|DOF1_ORYSJ Dof zinc finger protein 1	81.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card