TkA04G478030 | RubberDandelionOmics

Gene overview

TkA04G478030

Reference: TK1151 Chr: Chr04 Coordinates: 120718388-120720621 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1512 bp · TkA04G478030|TK1151|cDNA

CCCAAACCGCCTCACACGGTTGCATAACCACAGTTTCCTTCTATAATTGTGCCCTGCCCTTTGCAACCCACTTTGCATAAATAGTTCAATACAGATCGATCGATCAGCATACCTTCAGAATTAAGCAGCAATCACTTTTCAGACGATCTCATCTTTCTGTGAATCAATCATCTTGATCATGGCCGAAAACAATGTTCCAATTACTACTCAACCAGAGAGTGAACAAGAGAGGTTAAAGTACCTACAATTCGTGCAAGTAG...

CDS

Download CDS FASTA

627 bp · TkA04G478030|TK1151|CDS

ATGGCCGAAAACAATGTTCCAATTACTACTCAACCAGAGAGTGAACAAGAGAGGTTAAAGTACCTACAATTCGTGCAAGTAGCACTACTCCATGCAGTTGTGTATGCATCAAGAGTCTATGGCTACGCTAAAGACAACTCAGGTCCCCTAAAACCTGGCGTGGAGACAATAGAAGGCACTCTCAAGACTGTTGTGGGCCCTGCTTACGACAAGTTCTATGATGTCCCTGTTGAAGTCCTCAAGTTTGTTGACCGTAAGGT...

Protein

Download Protein FASTA

208 aa · TkA04G478030|TK1151|PROTEIN

MAENNVPITTQPESEQERLKYLQFVQVALLHAVVYASRVYGYAKDNSGPLKPGVETIEGTLKTVVGPAYDKFYDVPVEVLKFVDRKVDESVTIFDSRVPPLLKEVKTAGMMETASGLAKTAYTKIEPTAKGLYVKYEPVAEQYAASAWHSLNQLPLFLKVAKVVVPKAAYYSEKYNQTVQQSAEKGYKVSSYLPLVPTERIAKVFNNV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G478030`
TK1151 ID	TkA04G478030
OH-1004 ID	LXL04_038922
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	90.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G478030

Location Chr04:120718388-120720621 (-)

Description Similar to At3g05500: REF/SRPP-like protein At3g05500

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05500`	REF/SRPP-like protein At3g05500.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2Y0H2`	REF/SRPP-like protein OsI_017815.	No verified direct reference in this release
`Os05g0151300`	REF/SRPP-like protein Os05g0151300/LOC_Os05g05940.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038922 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0019915 lipid storage Biological Process

GO:0034389 lipid droplet organization Biological Process

GO:0045927 positive regulation of growth Biological Process

GO:0080186 developmental vegetative growth Biological Process

GO:1902584 positive regulation of response to water deprivation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005811 lipid droplet Cellular Component

KEGG gene cross-reference

ath:AT3G05500

dosa:Os05g0151300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.449

Rank 1 · TkA04G478030 · TK1151

Cell membrane0.228

Rank 2 · TkA04G478030 · TK1151

Nucleus0.197

Rank 3 · TkA04G478030 · TK1151

Mitochondrion0.153

Rank 4 · TkA04G478030 · TK1151

Endoplasmic reticulum0.124

Rank 5 · TkA04G478030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05755REF14-206 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G478030	`PF05755`	REF	14	206	5.4e-75	252.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MA63`	Arabidopsis thaliana	sp\|Q9MA63\|Y3550_ARATH REF/SRPP-like protein At3g05500	54.000%	Swiss-Prot	High
`A2Y0H2`	Oryza sativa subsp. indica	sp\|A2Y0H2\|Y5513_ORYSI REF/SRPP-like protein OsI_017815	50.000%	Swiss-Prot	High
`Q9FRA7`	Oryza sativa subsp. japonica	sp\|Q9FRA7\|Y5513_ORYSJ REF/SRPP-like protein Os05g0151300/LOC_Os05g05940	50.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card