TkA04G470420 | RubberDandelionOmics

Gene overview

TkA04G470420

Reference: TK1151 Chr: Chr04 Coordinates: 118817416-118818198 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

405 bp · TkA04G470420|TK1151|cDNA

ATGAGAACGATTTCAGCTGATCCTGACGAAATCGATGTCTTTCAACGTGATGTTGAAGAAGATGACTATATACCGACATTTCAACAGGAAGACGACGAATCTTCTGATGATTACGACGAAACAGATAACGTTTCAGGTTCAGTTTCTTCTTCCTCTATTGGCTCAAACTCCAGCAGCACCACAAGCAGATTTGTTGCAGAGAATAGTCACAACACGGATGTTCATGATGTTAAACCTGATGTCCCTGATGAATTCAAACC...

CDS

Download CDS FASTA

405 bp · TkA04G470420|TK1151|CDS

ATGAGAACGATTTCAGCTGATCCTGACGAAATCGATGTCTTTCAACGTGATGTTGAAGAAGATGACTATATACCGACATTTCAACAGGAAGACGACGAATCTTCTGATGATTACGACGAAACAGATAACGTTTCAGGTTCAGTTTCTTCTTCCTCTATTGGCTCAAACTCCAGCAGCACCACAAGCAGATTTGTTGCAGAGAATAGTCACAACACGGATGTTCATGATGTTAAACCTGATGTCCCTGATGAATTCAAACC...

Protein

Download Protein FASTA

134 aa · TkA04G470420|TK1151|PROTEIN

MRTISADPDEIDVFQRDVEEDDYIPTFQQEDDESSDDYDETDNVSGSVSSSSIGSNSSSTTSRFVAENSHNTDVHDVKPDVPDEFKPNNLMRFRTVNDAIDMYRSYAEKAGFDVRLNTERKSGERVIHKYLVKG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G470420`
TK1151 ID	TkA04G470420
OH-1004 ID	LXL04_031554
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.500
Protein coverage (%)	TK1151 98.507 / OH-1004 14.178 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G470420`
Location	Chr04:118817416-118818198 (-)
Description	Similar to FRS5: Protein FAR1-RELATED SEQUENCE 5
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031554` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0007623 circadian rhythm Biological Process GO:0009585 red, far-red light phototransduction Biological Process GO:0009639 response to red or far red light Biological Process GO:0010017 red or far-red light signaling pathway Biological Process GO:0010018 far-red light signaling pathway Biological Process GO:0010218 response to far red light Biological Process GO:0042753 positive regulation of circadian rhythm Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:1900056 negative regulation of leaf senescence Biological Process GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	ath:AT1G52520 ath:AT3G22170 ath:AT4G15090 ath:AT4G38180 ath:AT5G28530 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.944

Rank 1 · TkA04G470420 · TK1151

Cytoplasm0.236

Rank 2 · TkA04G470420 · TK1151

Mitochondrion0.018

Rank 3 · TkA04G470420 · TK1151

Cell membrane0.016

Rank 4 · TkA04G470420 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA04G470420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15290Syntaphilin38-85 aa

PF15650Tox-REase-961-109 aa

PF03101FAR1102-124 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G470420	`PF15290`	Syntaphilin	38	85	0.075	13.4
TkA04G470420	`PF15650`	Tox-REase-9	61	109	0.21	12.7
TkA04G470420	`PF03101`	FAR1	102	124	0.09	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card