TkA04G341960 | RubberDandelionOmics

Gene overview

TkA04G341960

Reference: TK1151 Chr: Chr04 Coordinates: 86334590-86337596 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1946 bp · TkA04G341960|TK1151|cDNA

CCACCCACACCGGCGAGACATGGCGCCGTACAATTCGCTTCTCCTAATCACACTCTCATCTCTCCTCATCTTCACCGTCGCCGGCCGTGTAATCACCACCACATCACCACCAAACCCCATCTCCGACGGCATTAACAATGGACCCGGAACCATTCTTCGTCTCAACGATCCCTTGATCATATCATCTGACGTCGACGACACAGTTGCGTCTTGCAAGCATACATATGGATTCATACCTTGCAGCAATGGATTTTTTCTCA...

CDS

Download CDS FASTA

1170 bp · TkA04G341960|TK1151|CDS

ATGGCGCCGTACAATTCGCTTCTCCTAATCACACTCTCATCTCTCCTCATCTTCACCGTCGCCGGCCGTGTAATCACCACCACATCACCACCAAACCCCATCTCCGACGGCATTAACAATGGACCCGGAACCATTCTTCGTCTCAACGATCCCTTGATCATATCATCTGACGTCGACGACACAGTTGCGTCTTGCAAGCATACATATGGATTCATACCTTGCAGCAATGGATTTTTTCTCAGCCTCTGTCTTCTTTTACT...

Protein

Download Protein FASTA

389 aa · TkA04G341960|TK1151|PROTEIN

MAPYNSLLLITLSSLLIFTVAGRVITTTSPPNPISDGINNGPGTILRLNDPLIISSDVDDTVASCKHTYGFIPCSNGFFLSLCLLLLYSYVIQVASSNLSDGSELLLHVLGPGVVGGLFLPIFGSVPEAMIILASGLAGSVEVAQGQVSIGMGLLAGSIVMLLTLIWGACVTSGKSDLEDSVAIDNQDTKASNDLTGSGVSTDIWTSYSAMIMVVSVIPLIVLQFPQIIHSTTGVQISVLVGLIFSVTLLVAYCVYQVIQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G341960`
TK1151 ID	TkA04G341960
OH-1004 ID	LXL04_037709
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.100
Protein coverage (%)	TK1151 96.658 / OH-1004 64.716 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G341960

Location Chr04:86334590-86337596 (-)

Description Similar to NCL: Sodium/calcium exchanger NCL

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53210`	Possesses sodium/calcium exchanger (NCX) activity when expressed in a heterologous mammalian CHO-K1 cell system.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0212400`	May function as a sodium/calcium exchanger (NCX) and participate in the maintenance of calcium homeostasis.	No verified direct reference in this release
`Os02g0247800`	May function as a sodium/calcium exchanger (NCX) and participate in the maintenance of calcium homeostasis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037709 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006814 sodium ion transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0055074 calcium ion homeostasis Biological Process

GO:0070588 calcium ion transmembrane transport Biological Process

GO:0071472 cellular response to salt stress Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G53210

dosa:Os01g0212400

dosa:Os02g0247800

osa:4325568

osa:4328874

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.451

Rank 1 · TkA04G341960 · TK1151

Lysosome / Vacuole0.282

Rank 2 · TkA04G341960 · TK1151

Endoplasmic reticulum0.168

Rank 3 · TkA04G341960 · TK1151

Cytoplasm0.090

Rank 4 · TkA04G341960 · TK1151

Golgi apparatus0.060

Rank 5 · TkA04G341960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01699Na_Ca_ex9-20 aa

PF01699Na_Ca_ex81-260 aa

PF23564EF-hand_FSTL1295-373 aa

PF13833EF-hand_8299-328 aa

PF10591SPARC_Ca_bdg302-365 aa

PF13499EF-hand_7304-364 aa

PF00036EF-hand_1306-328 aa

PF13405EF-hand_6306-328 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G341960	`PF01699`	Na_Ca_ex	9	20	3.6e-08	34.2
TkA04G341960	`PF01699`	Na_Ca_ex	81	260	3.6e-08	34.2
TkA04G341960	`PF23564`	EF-hand_FSTL1	295	373	0.012	16.8
TkA04G341960	`PF13833`	EF-hand_8	299	328	0.08	13.4
TkA04G341960	`PF10591`	SPARC_Ca_bdg	302	365	0.15	13.1
TkA04G341960	`PF13499`	EF-hand_7	304	364	4.1e-08	34.2
TkA04G341960	`PF00036`	EF-hand_1	306	328	1.7e-07	31.0
TkA04G341960	`PF13405`	EF-hand_6	306	328	6.5e-05	23.0
TkA04G341960	`PF13202`	EF-hand_5	307	328	0.037	14.2
TkA04G341960	`PF13833`	EF-hand_8	326	366	0.08	13.4
TkA04G341960	`PF00036`	EF-hand_1	344	368	1.7e-07	31.0
TkA04G341960	`PF13202`	EF-hand_5	344	364	0.037	14.2
TkA04G341960	`PF13405`	EF-hand_6	346	369	6.5e-05	23.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L636`	Arabidopsis thaliana	sp\|Q8L636\|NCL_ARATH Sodium/calcium exchanger NCL	48.100%	Swiss-Prot	Medium
`Q5QNI2`	Oryza sativa subsp. japonica	sp\|Q5QNI2\|NCL1_ORYSJ Sodium/calcium exchanger NCL1	44.700%	Swiss-Prot	Medium
`Q6K3R5`	Oryza sativa subsp. japonica	sp\|Q6K3R5\|NCL2_ORYSJ Sodium/calcium exchanger NCL2	51.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card