TkA04G189960 | RubberDandelionOmics

Gene overview

TkA04G189960

Reference: TK1151 Chr: Chr04 Coordinates: 48978769-48982398 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3509 bp · TkA04G189960|TK1151|cDNA

TCGTTAAGATGTGATGTAGTTAGATGGTTTGATGTCTAATCCATGATTTTTAGATCAAAAAACTAAGAAGCAATCAAATTTTCTACAATGTCTTGATTAATGACAATTGATTTGTGAGCAATTTTCTACAAGTTATAACCAAATCCACATGCACGGTTTTTTTTTTTTTTTTTTTTTACTTTCTATTGTATACTTTATTACAACATTTGAAATGGACATAACCCCAACTTCCCACTTCTTCATCACTTTGAGCCATTTAT...

CDS

Download CDS FASTA

1521 bp · TkA04G189960|TK1151|CDS

ATGTGCATGTGTATCAACTTATGCATGAATACATCAATTTCTTACATCATATCTTATATTTCCCTAATATACAAGCAAACCATCCCTTACCATACTCAAATCCATCTCATAGTTCCCATGGTAATGGAGGAAATGAAGATGATAACAAGCATAGGCTTCCCTCTTTTCACAATGGGGTTGGTTAGTTACCTGAAAAACATGATTGCAGTTGCATGCATGGGCAAAATGGGAAGACTTGAGTTAGCGGGTGGTGCATTAGC...

Protein

Download Protein FASTA

506 aa · TkA04G189960|TK1151|PROTEIN

MCMCINLCMNTSISYIISYISLIYKQTIPYHTQIHLIVPMVMEEMKMITSIGFPLFTMGLVSYLKNMIAVACMGKMGRLELAGGALAIGFTNITGYSVLSGLAMGMEPLCSQAFGSRNLTMVNLTLQRTIIILLFASLPIGVLWVNLEPLMIFLHQDPDITRVASLYCRYAIPDLIVNSFLYPLKIFLRSKGATWSLMWCTLIPTLVHYPITNTLAFTLHLGVKGVAISTFLTNLITSVLILGYIFSTHNTPKSETTVKG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G189960`
TK1151 ID	TkA04G189960
OH-1004 ID	LXL04_029876
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G189960

Location Chr04:48978769-48982398 (-)

Description Similar to DTX55: Protein DETOXIFICATION 55

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49130`	Protein DETOXIFICATION 55.	No verified direct reference in this release
`At1g71870`	May function as a multidrug and toxin extrusion transporter in the export of IAA-conjugates from the cytoplasm into peroxisomes.	No verified direct reference in this release
`At4g23030`	Protein DETOXIFICATION 49.	No verified direct reference in this release
`At4g29140`	Functions as a multidrug and toxin extrusion transporter that negatively regulates plant disease resistance.	ADP1 affects plant architecture by regulating local auxin biosynthesis.2014 · DOI: 10.1371/journal.pgen.1003954 A subgroup of MATE transporter genes regulates hypocotyl cell elongation in Arabidopsis.2015 · DOI: 10.1093/jxb/erv344
`At1g58340`	Functions as a multidrug and toxin extrusion transporter.	A Golgi-localized MATE transporter mediates iron homoeostasis under osmotic stress in Arabidopsis.2012 · DOI: 10.1042/bj20111311 A subgroup of MATE transporter genes regulates hypocotyl cell elongation in Arabidopsis.2015 · DOI: 10.1093/jxb/erv344

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029876 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006826 iron ion transport Biological Process

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009624 response to nematode Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010015 root morphogenesis Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010600 regulation of auxin biosynthetic process Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0046620 regulation of organ growth Biological Process

KEGG gene cross-reference

ath:AT1G58340

ath:AT1G71870

ath:AT4G29140

ath:AT5G19700

ath:AT5G49130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.446

Rank 1 · TkA04G189960 · TK1151

Lysosome / Vacuole0.272

Rank 2 · TkA04G189960 · TK1151

Cytoplasm0.119

Rank 3 · TkA04G189960 · TK1151

Endoplasmic reticulum0.107

Rank 4 · TkA04G189960 · TK1151

Golgi apparatus0.070

Rank 5 · TkA04G189960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01554MatE54-211 aa

PF01554MatE220-241 aa

PF01554MatE275-437 aa

PF06149DUF969348-398 aa

PF06149DUF969429-465 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G189960	`PF01554`	MatE	54	211	6.2e-61	205.5
TkA04G189960	`PF01554`	MatE	220	241	6.2e-61	205.5
TkA04G189960	`PF01554`	MatE	275	437	6.2e-61	205.5
TkA04G189960	`PF06149`	DUF969	348	398	0.67	10.2
TkA04G189960	`PF06149`	DUF969	429	465	0.67	10.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FH21`	Arabidopsis thaliana	sp\|Q9FH21\|DTX55_ARATH Protein DETOXIFICATION 55	60.500%	Swiss-Prot	High
`Q9LE20`	Arabidopsis thaliana	sp\|Q9LE20\|DTX54_ARATH Protein DETOXIFICATION 54	48.500%	Swiss-Prot	Medium
`O82752`	Arabidopsis thaliana	sp\|O82752\|DTX49_ARATH Protein DETOXIFICATION 49	48.200%	Swiss-Prot	Medium
`Q9SZE2`	Arabidopsis thaliana	sp\|Q9SZE2\|DTX51_ARATH Protein DETOXIFICATION 51	47.600%	Swiss-Prot	Medium
`Q9SLV0`	Arabidopsis thaliana	sp\|Q9SLV0\|DTX48_ARATH Protein DETOXIFICATION 48	46.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card