TkA04G128060 | RubberDandelionOmics

Gene overview

TkA04G128060

Reference: TK1151 Chr: Chr04 Coordinates: 33311312-33313732 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2091 bp · TkA04G128060|TK1151|cDNA

GCGACAGCACTAACGTACAACCCCACGCCAGCGCATTTTAGCCTTAACGCCCGCATATTCTACTCTCGTATAAAACAACCCTCCCCTACCTCCGAAACTAACGCACGTCGGCCATCGTCCCCACTAACTGCCACCACTCACTTCCTCATGGATCTCCGGCGTAGACTCCCTCCTAAACCTCCATCCGCCACCGTCCTCAACCACCAGAAGGCTGTTTCCAACGGTGAAAATCGGTCGTCTTCCTCCACGAAGACTGGTCT...

CDS

Download CDS FASTA

1887 bp · TkA04G128060|TK1151|CDS

GCGACAGCACTAACGTACAACCCCACGCCAGCGCATTTTAGCCTTAACGCCCGCATATTCTACTCTCGTATAAAACAACCCTCCCCTACCTCCGAAACTAACGCACGTCGGCCATCGTCCCCACTAACTGCCACCACTCACTTCCTCATGGATCTCCGGCGTAGACTCCCTCCTAAACCTCCATCCGCCACCGTCCTCAACCACCAGAAGGCTGTTTCCAACGGTGAAAATCGGTCGTCTTCCTCCACGAAGACTGGTCT...

Protein

Download Protein FASTA

628 aa · TkA04G128060|TK1151|PROTEIN

ATALTYNPTPAHFSLNARIFYSRIKQPSPTSETNARRPSSPLTATTHFLMDLRRRLPPKPPSATVLNHQKAVSNGENRSSSSTKTGLIDRSPSPVPKASDALPLPLYLTNGIFFTLFFSVAYYLLHRWRDKIRSSTPLHVVTLSELAAIVSLIASFIYLLGFFGIDFVQSFITTARSEEDSFVLEGEVEQHSEPKPRIMDPIPSLALASEEDEEIVKSVVCGSVPSYSLESKLGDCLRAASIRRQALERTTGRSLLGLPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G128060`
TK1151 ID	TkA04G128060
OH-1004 ID	LXL04_035473
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 99.683 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G128060

Location Chr04:33311312-33313732 (+)

Description Similar to HMGR1: 3-hydroxy-3-methylglutaryl coenzyme A reductase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76490`	Catalyzes the synthesis of mevalonate, the specific precursor of all isoprenoid compounds present in plants.	Chemical phenotypes of the hmg1 and hmg2 mutants of Arabidopsis demonstrate the in-planta role of HMG-CoA reductase in triterpene biosynthesis.2007 · DOI: 10.1248/cpb.55.1518 Complete blockage of the mevalonate pathway results in male gametophyte lethality.2009 · DOI: 10.1093/jxb/erp073

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035473 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008299 isoprenoid biosynthetic process Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0015936 coenzyme A metabolic process Biological Process

GO:0016104 triterpenoid biosynthetic process Biological Process

GO:0016126 sterol biosynthetic process Biological Process

GO:0016135 saponin biosynthetic process Biological Process

GO:0019287 isopentenyl diphosphate biosynthetic process, mevalonate pathway Biological Process

GO:0005778 peroxisomal membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G76490

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.658

Rank 1 · TkA04G128060 · TK1151

Mitochondrion0.200

Rank 2 · TkA04G128060 · TK1151

Endoplasmic reticulum0.073

Rank 3 · TkA04G128060 · TK1151

Cytoplasm0.073

Rank 4 · TkA04G128060 · TK1151

Nucleus0.053

Rank 5 · TkA04G128060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19606DUF6111111-179 aa

PF00368HMG-CoA_red240-616 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G128060	`PF19606`	DUF6111	111	179	0.02	15.9
TkA04G128060	`PF00368`	HMG-CoA_red	240	616	2.9e-144	481.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P14891`	Arabidopsis thaliana	sp\|P14891\|HMDH1_ARATH 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1	77.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card