Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2358 bp · TkA04G007210|TK1151|cDNA
GATTTCACAGACGATCGGGAACCATCTTCGTCAAATAATGACAGCTTGGACATATCAAGGTTTTCAATAGAGAATGAGGTTGCCCGATCGGAGAGGCAAGGGCGTTTCTGAGGTTTAGAAGATGATGTGGGGTTATTATTGTTGGTGTTATCGGATTTATCTAGGGTTTTGTTGAGCGTGGTAGGGAGATAAAAAGGTCTCCAGCTATGGAGCTGGAACGTACATGTATCTATGGCGTGACGCGAACTTCCTATGGTTCT...
1563 bp · TkA04G007210|TK1151|CDS
ATGTCGAATGTTGTTCATCTTCTTATTCTCTTTCTTCTTCTGGTGATCGGAAGTTCTAACGATGTACGATTCTTCGTATACGGCGTGGCTGATGAATATCGAAGAGAAGATTTTCCCGCTGAATTCGTGTTTGGTTCAGGAACTTCCGCTTATCAGGTTGAAGGAGCAGTACTGGAAGATGGAAGGACTTTCAGCATTTGGGACACATTCGCTCATACAGGCTACTACAATGGAGCAAATGGAGACATAGCATGTGACGG...
Protein
Download Protein FASTA520 aa · TkA04G007210|TK1151|PROTEIN
MSNVVHLLILFLLLVIGSSNDVRFFVYGVADEYRREDFPAEFVFGSGTSAYQVEGAVLEDGRTFSIWDTFAHTGYYNGANGDIACDGYHKYKEDIELMAKTGLEAFRFSISWSRLIPDGRGPVNVKGLQFYNDFINRLIAHGIQPHVTLHHDDLPQILENEYGGWLSRKSVKDYVAYADICFREFGDRVLHWTTFNEANVFTLGGYDMGFSPPGRCSTPFGLINCTVGNSTYEPYLAAHHLLLAHASTVRLYRKKYKAMQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G007210 |
|---|---|
| TK1151 ID | TkA04G007210 |
| OH-1004 ID | LXL04_037063 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 99.800 |
| Protein coverage (%) | TK1151 98.077 / OH-1004 49.611Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G007210 | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:1706829-1714907 (+) | ||||||||||||||||||||||||||||||||||||
| Description | Similar to LCT: Lactase-phlorizin hydrolase | ||||||||||||||||||||||||||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||||||||||||||||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||||||||||||||||||||||||||
| GO annotations (OH1004 source) | GO:0001666 response to hypoxia Biological Process GO:0005990 lactose catabolic process Biological Process GO:0007584 response to nutrient Biological Process GO:0009410 response to xenobiotic stimulus Biological Process GO:0009725 response to hormone Biological Process GO:0009744 response to sucrose Biological Process GO:0010040 response to iron(II) ion Biological Process GO:0010045 response to nickel cation Biological Process GO:0010288 response to lead ion Biological Process GO:0042594 response to starvation Biological Process GO:0043627 response to estrogen Biological Process GO:0045471 response to ethanol Biological Process | ||||||||||||||||||||||||||||||||||||
| KEGG gene cross-reference | hsa:3938 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00232Glyco_hydro_136-498 aaPF00150Cellulase90-176 aaPF00150Cellulase268-291 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G007210 | PF00232 | Glyco_hydro_1 | 36 | 498 | 2.6e-139 | 465.4 |
| TkA04G007210 | PF00150 | Cellulase | 90 | 176 | 0.0015 | 18.8 |
| TkA04G007210 | PF00150 | Cellulase | 268 | 291 | 0.0015 | 18.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
B3H5Q1 | Arabidopsis thaliana | sp|B3H5Q1|BGL11_ARATH Beta-glucosidase 11 | 59.000% | Swiss-Prot | High |
Q93ZI4 | Arabidopsis thaliana | sp|Q93ZI4|BGL10_ARATH Beta-glucosidase 10 | 54.300% | Swiss-Prot | High |
Q3ECW8 | Arabidopsis thaliana | sp|Q3ECW8|BGL01_ARATH Beta-glucosidase 1 | 69.700% | Swiss-Prot | High |
O65458 | Arabidopsis thaliana | sp|O65458|BGL03_ARATH Beta-glucosidase 3 | 67.500% | Swiss-Prot | High |
Q9ZUI3 | Arabidopsis thaliana | sp|Q9ZUI3|BGL04_ARATH Beta-glucosidase 4 | 58.800% | Swiss-Prot | High |
Q60DX8 | Oryza sativa subsp. japonica | sp|Q60DX8|BGL22_ORYSJ Beta-glucosidase 22 | 57.100% | Swiss-Prot | High |
Q0DIT2 | Oryza sativa subsp. japonica | sp|Q0DIT2|BGL19_ORYSJ Beta-glucosidase 19 | 61.400% | Swiss-Prot | High |
B7F8N7 | Oryza sativa subsp. japonica | sp|B7F8N7|BGL02_ORYSJ Beta-glucosidase 2 | 60.900% | Swiss-Prot | High |
Q8RZL1 | Oryza sativa subsp. japonica | sp|Q8RZL1|BGL03_ORYSJ Beta-glucosidase 3 | 61.400% | Swiss-Prot | High |
Q60DY1 | Oryza sativa subsp. japonica | sp|Q60DY1|BGL21_ORYSJ Beta-glucosidase 21 | 58.600% | Swiss-Prot | High |