TkA03G572750 | RubberDandelionOmics

Gene overview

TkA03G572750

Reference: TK1151 Chr: Chr03 Coordinates: 145262752-145268062 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2400 bp · TkA03G572750|TK1151|cDNA

ATGGAGAAACAGTCGTCGTCGTCGTGGAGCGCAGGTGGTGGCGGAGGGCTGAGGTGGTCGGAAACAAGAAGGGATCAGGTGCTAGCAATCGCCGGTGTGGAAAATCGAGAGAGGAGGTTAAGGAAGCTGAGACGCTTACAAGATGACAGAGCACCTGATATGTCACCGGAAAACTTGTTGGATGCTAAATCTAGAAAACGCAGAGATCAGAGGAAGAGTCCCGTTTCGTTACCTGTGACTGTGCTTGATCTAGACGAAGA...

CDS

Download CDS FASTA

2400 bp · TkA03G572750|TK1151|CDS

ATGGAGAAACAGTCGTCGTCGTCGTGGAGCGCAGGTGGTGGCGGAGGGCTGAGGTGGTCGGAAACAAGAAGGGATCAGGTGCTAGCAATCGCCGGTGTGGAAAATCGAGAGAGGAGGTTAAGGAAGCTGAGACGCTTACAAGATGACAGAGCACCTGATATGTCACCGGAAAACTTGTTGGATGCTAAATCTAGAAAACGCAGAGATCAGAGGAAGAGTCCCGTTTCGTTACCTGTGACTGTGCTTGATCTAGACGAAGA...

Protein

Download Protein FASTA

799 aa · TkA03G572750|TK1151|PROTEIN

MEKQSSSSWSAGGGGGLRWSETRRDQVLAIAGVENRERRLRKLRRLQDDRAPDMSPENLLDAKSRKRRDQRKSPVSLPVTVLDLDEDEGCKEEEKKEQKIDVDNNSKKDGKSMKKEHALTDFVKHSLVHYADFVICEKKKGFVNGKVKRPAEDEQNFEIWQRCNDMVMSWILNVLASDISESVLYSSSAFDIWKDLDDRFGQSNGAKLYQLQRKSQIYLKPLPSVTQAYALLIQDEKQREVQSASTFINESASMNVKSGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G572750`
TK1151 ID	TkA03G572750
OH-1004 ID	LXL04_021085
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	47.700
Protein coverage (%)	TK1151 66.959 / OH-1004 23.355 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G572750

Location Chr03:145262752-145268062 (+)

Description Similar to RE1: Retrovirus-related Pol polyprotein from transposon RE1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q94HW2`	Retrovirus-related Pol polyprotein from transposon RE1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021085 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006508 proteolysis Biological Process

GO:0015074 DNA integration Biological Process

GO:0003676 nucleic acid binding Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.764

Rank 1 · TkA03G572750 · TK1151

Cytoplasm0.314

Rank 2 · TkA03G572750 · TK1151

Mitochondrion0.037

Rank 3 · TkA03G572750 · TK1151

Cell membrane0.024

Rank 4 · TkA03G572750 · TK1151

Endoplasmic reticulum0.018

Rank 5 · TkA03G572750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14223Retrotran_gag_2141-208 aa

PF00665rve350-374 aa

PF22936Pol_BBD363-437 aa

PF13976gag_pre-integrs497-550 aa

PF00665rve568-665 aa

PF29688TnsB_C584-612 aa

PF29688TnsB_C631-681 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G572750	`PF14223`	Retrotran_gag_2	141	208	0.012	16.2
TkA03G572750	`PF00665`	rve	350	374	2.9e-10	41.0
TkA03G572750	`PF22936`	Pol_BBD	363	437	9.5e-17	61.8
TkA03G572750	`PF13976`	gag_pre-integrs	497	550	1.3e-07	32.0
TkA03G572750	`PF00665`	rve	568	665	2.9e-10	41.0
TkA03G572750	`PF29688`	TnsB_C	584	612	0.051	14.1
TkA03G572750	`PF29688`	TnsB_C	631	681	0.051	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94HW2`	Arabidopsis thaliana	sp\|Q94HW2\|POLR1_ARATH Retrovirus-related Pol polyprotein from transposon RE1	28.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card