TkA03G549670 | RubberDandelionOmics

Gene overview

TkA03G549670

Reference: TK1151 Chr: Chr03 Coordinates: 139101014-139101991 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

648 bp · TkA03G549670|TK1151|cDNA

ATGAATATCGCACAAACCACATCATTCGTCATGGTGGTTCTTTCTTCATACAGAGCACATCGCTCGTTGGTGGTTACTTGTTGCATGGTACAGTGCGATCCTTCGGGTCTTTGTACAGCGTCTTCATATCAAGTTAATCCTACTGCAATGGTATATTACTGTTTAGACACACTTGAAAGATTAGGAATTAAACGACATTTCAAGATGGAAATCCAAAATGTTTTAGACAAAACATATAGATGTTGGATGCAGGGGGACGT...

CDS

Download CDS FASTA

648 bp · TkA03G549670|TK1151|CDS

ATGAATATCGCACAAACCACATCATTCGTCATGGTGGTTCTTTCTTCATACAGAGCACATCGCTCGTTGGTGGTTACTTGTTGCATGGTACAGTGCGATCCTTCGGGTCTTTGTACAGCGTCTTCATATCAAGTTAATCCTACTGCAATGGTATATTACTGTTTAGACACACTTGAAAGATTAGGAATTAAACGACATTTCAAGATGGAAATCCAAAATGTTTTAGACAAAACATATAGATGTTGGATGCAGGGGGACGT...

Protein

Download Protein FASTA

215 aa · TkA03G549670|TK1151|PROTEIN

MNIAQTTSFVMVVLSSYRAHRSLVVTCCMVQCDPSGLCTASSYQVNPTAMVYYCLDTLERLGIKRHFKMEIQNVLDKTYRCWMQGDVLIFMDVDTCALAFRVLRSNGYEVSSDPLAKLIKEGNHMNSPEKPFKDVYTALEVYKASQITYQDELAFEEQNLTSYLPLSKEVDDALKFPFNGSLERMSTRRNIEHYNINHTRILKTTYRLRASSTYM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G549670`
TK1151 ID	TkA03G549670
OH-1004 ID	LXL04_010803
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	86.700
Protein coverage (%)	TK1151 91.163 / OH-1004 39.914 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G549670`
Location	Chr03:139101014-139101991 (+)
Description	Similar to TPS4: Ent-kaurene synthase TSP4, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_010803` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009686 gibberellin biosynthetic process Biological Process GO:0016114 terpenoid biosynthetic process Biological Process GO:0033331 ent-kaurene metabolic process Biological Process GO:0033332 ent-kaurene biosynthetic process Biological Process GO:0009507 chloroplast Cellular Component GO:0031969 chloroplast membrane Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0009899 ent-kaurene synthase activity Molecular Function GO:0010333 terpene synthase activity Molecular Function GO:0102161 copal-8-ol diphosphate synthase activity Molecular Function
KEGG gene cross-reference	ag:AHJ59325 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.613

Rank 1 · TkA03G549670 · TK1151

Cytoplasm0.259

Rank 2 · TkA03G549670 · TK1151

Nucleus0.138

Rank 3 · TkA03G549670 · TK1151

Mitochondrion0.114

Rank 4 · TkA03G549670 · TK1151

Peroxisome0.057

Rank 5 · TkA03G549670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01397Terpene_synth52-166 aa

PF02944BESS64-77 aa

PF02944BESS182-191 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G549670	`PF01397`	Terpene_synth	52	166	2.1e-27	96.7
TkA03G549670	`PF02944`	BESS	64	77	0.13	12.8
TkA03G549670	`PF02944`	BESS	182	191	0.13	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card